[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:csaA"

csaA        "secretion chaperone"
            ""

OrgPattern 11-1--1-----------------1----------111----------1--1---------111---- 1---------------------------------------------------------------------------------1-----1111-111---2-2211211-1-----------------1------2----------1---------11------------1-------------11-11---111222221122111112-11111112--111--------1--------------------------------------------------------------------------------------------11--1111111-1-1-------1-1----1--------1-----1-1----21----------111--------11111111111-11-11-1-11--1111111111111-1111111111111--------111-1-11--------------11-------------11--1--11----------------------------------------1---------2--1--------------11-1--2211222211--------------1-------------1--------------11--------------------------11-------------------------------------------------------111----------------1------------------------------1111--------------------111111------1111----1---------------------1---------------------------1----11-------------------------------------11---------- ----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSGEISYADFEKVDIRVGTIVEAVPFPEARKPAIKVKIDFGPEIGIKKSSAQITVHYTPE:Sequence : ccEEEEcccccTTEEEEEEEEEEEETTTTEccEEEEEEcccEEEEEEccccccTcEEEE:Sec Str : =========================================================:RP:SCP|4->112|1pxfA|6e-22|29.2|106/111|b.40.4.4 : ====================================================:BL:SWS|9->112|CSAA_BACSU|2e-34|64.4|104/110 61: . . . * . .: 120 :SLVGRQVLGVVNFPPRQIGPFRSEVLTLGFADANGDIVLAAVERPVPNGEKMC :Sequence :EcTTcccccccccccEEccccEEccEEccHHHcccEEEEccccTTccTTcccc :Sec Str :==================================================== :RP:SCP|4->112|1pxfA|6e-22|29.2|106/111|b.40.4.4 :==================================================== :BL:SWS|9->112|CSAA_BACSU|2e-34|64.4|104/110