[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:dnaJ.3"

dnaJ        "molecular chaperone, DnaJ family"
            ""

OrgPattern -------------------------------1------------------------------11---- ---11------------11-1-1111111111-1111---1--1----111-11--11----1111-11111111----1112---------------------11-1----------------------------11111--------------111111-1---------11-1--11-1-12------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------1-1------1-----1---------1-11211-111-1----------1-11111-1---1-21123323332211-----1----------------------1------------------------------21121-----------------------------------------------------------------1---------1---------------------1------------------------------11----------------------------------1-------------------------------------------------------------------------------1-------------------------1-----------------------------------------------1111111111--------------11111111111111--1---------------------------------------1-----1--------1- 1-11----1-1----1--1-32--2-111-1221111322132111--11----11-121221----11------------1111111-322-3221112231----27-4-----------1------281-21-----1--1--1---1--------111-2--141--122-4443J433238696-552111128 -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-

Master   AminoSeq   


1: . . . . + .: 60 :MIDPYVLLGVERDADEAAIKTAYRKVAKAAHPDSGGDGEQFARLQTAYELLKDPVRRRVF:Sequence :cccHHHHHTccTTccHHHHHHHHHHHHHHTcTTTcTHHHHHHHHHHHHHHHHcHHHHHHH:Sec Str : ####################:PROS|41->60|PS00636|DNAJ_1|PDOC00553| : ==========================================================:RP:SCP|3->66|1gh6A|5e-14|35.9|64/114|a.2.3.1 : ========================================================:BL:SWS|5->66|DNJH_CUCSA|2e-13|48.4|62/413 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->60|PF00226|2e-05|48.3|58/63|DnaJ 61: . . . * . .: 120 :DDTGYDPQLADAKDLKGLLMLETLVNEFILDEREPGSFDPVAAMRRKLTDDILKSRFHIL:Sequence :HHcccccHcccHHHHHc :Sec Str :====== :RP:SCP|3->66|1gh6A|5e-14|35.9|64/114|a.2.3.1 :====== :BL:SWS|5->66|DNJH_CUCSA|2e-13|48.4|62/413 121: . . + . . .: 180 :ELERHRTRVRKHMDRLGRKPETDVLSSMLRARSQSIAEAIRNAETQIEAIEQAYTMLEGY:Sequence : :Sec Str 181: . * . . . .: 240 :SYELETVTLAEPLLKGEAAE :Sequence : :Sec Str