[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:fabI.2"

fabI        "enoyl-(acyl-carrier-protein) reductase"
            ""

OrgPattern --1-111211211111-3--11112--2-322-1-------------1--2-1-1-11--1-222-11 5AB27--2223-2-BG988-8H229K878889FKLL9GHJ433J31221231533113114382939BA62---------31721222223312--2--439269I693A22222222222222233243322432111222225234542241211111112121365F31111211111114332212-62A55555455454555496557A4555A9667233333369322222122222221344552-111112-1-11221111222-1111-111111--111111111111111111111111-11---111-22238333222232212331233-321-23---12----1321111231-316B55522222A8IAA215A689644444444449-57865A46BIA2GCC6EAFMJLBCCA373976587886833333333487522652222222211111111111111111111115EB5267369DEHBIB68888BBFI777736H7D9II724874624657584BC2431344411111111114644161121111111121322232111222575--3222222222122222222222222333311253142-14435453544443345-11-1122112122255633637774756577-7777776767766677775BB983312656566766766665667776557213444444344441122-1---222212675222314222222232899A946354758778697856254698A22222222221112-----32-2233668551111111211-332222--------1----------------------------12-11-121262 11--1-3-1----2338467875E8D8221223212-423134---78526BJI57663655343-31141121211111256666-6-45283823235323323-342J35763-2---13-21-213C3-2-2-13-32241-2-212--121345DD72C698445136443311M11124553J4C23253232 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAQASGLMAGKRGLIMGVANNRSIAWGIAKACADAGAELALTWQGDALKKRVEPLAQELG:Sequence :ccGGGGccTTcEEEETTTTcHHHHHHHHHHHHTTcEEEEEEcccHHHHHHHHHHHHHTTc:Sec Str : =======================================================:RP:SCP|6->259|1c14A|4e-40|50.4|254/256|c.2.1.2 :============================================================:BL:SWS|1->272|FABI1_RHIME|e-131|84.2|272/272 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->181|PF00106|5e-08|27.6|152/169|adh_short 61: . . . * . .: 120 :AFMAGHCDVTDLETIDSVFASLEQHWGKIDFVVHAIAFSDKDELTGRYLDTSRDNFNRTM:Sequence :cEEEEEccTTcHHHHHHHHHHHHHHHccccEEEEccccccTTcccccGGGccHHHHHHHH:Sec Str :============================================================:RP:SCP|6->259|1c14A|4e-40|50.4|254/256|c.2.1.2 :============================================================:BL:SWS|1->272|FABI1_RHIME|e-131|84.2|272/272 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->181|PF00106|5e-08|27.6|152/169|adh_short 121: . . + . . .: 180 :DISVFSLAAVAKRAEPIMNDGGSIITLTYYGAEKVMPNYNVMGVAKAALEASVRYLAVDL:Sequence :HHHTHHHHHHHHHHHHHcTTcEEEEEccGGGTcccccccHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|6->259|1c14A|4e-40|50.4|254/256|c.2.1.2 :============================================================:BL:SWS|1->272|FABI1_RHIME|e-131|84.2|272/272 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->181|PF00106|5e-08|27.6|152/169|adh_short 181: . * . . . .: 240 :GNRGIRVNAVSAGPIKTLAASGIGDFRYILKWNEYNAPLKRTVTIEEVGKSALYLLSDLS:Sequence :GGGTcEEEEEEEcccccHHHHHHGGGGcTTcTTccHHTTcccccHHHHHHHHHHHHcGGG:Sec Str :============================================================:RP:SCP|6->259|1c14A|4e-40|50.4|254/256|c.2.1.2 :============================================================:BL:SWS|1->272|FABI1_RHIME|e-131|84.2|272/272 :$ :RP:PFM|24->181|PF00106|5e-08|27.6|152/169|adh_short 241: + . . . . *: 300 :TAVTGEIHHVDSGYHTIGMKAVDAPDISVVKD :Sequence :TTccccEEEEcccccGcccccTTcTTcHHHHH :Sec Str :=================== :RP:SCP|6->259|1c14A|4e-40|50.4|254/256|c.2.1.2 :================================ :BL:SWS|1->272|FABI1_RHIME|e-131|84.2|272/272