[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAK86566.1 atum0 fabI.2 "enoyl-(acyl-carrier-protein) reductase"
MAQASGLMAGKRGLIMGVANNRSIAWGIAKACADAGAELALTWQGDALKKRVEPLAQELG
AFMAGHCDVTDLETIDSVFASLEQHWGKIDFVVHAIAFSDKDELTGRYLDTSRDNFNRTM
DISVFSLAAVAKRAEPIMNDGGSIITLTYYGAEKVMPNYNVMGVAKAALEASVRYLAVDL
GNRGIRVNAVSAGPIKTLAASGIGDFRYILKWNEYNAPLKRTVTIEEVGKSALYLLSDLS
TAVTGEIHHVDSGYHTIGMKAVDAPDISVVKD
//