[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:gltB.1"

gltB        "glutamate synthase large subunit"
            ""

OrgPattern ---1--1111111111-11111111--111111131111111111-211-1111-1-----1------ 11111--111111121111-13112211111233331464122111-11111111122--112111211211111111----111111--1111-----1-1-3221211---------------1111221122111111111112121112111111111112111111111111111111111111--121111111111111111111121111211-21111111111-1111111111111111-11----11---------11----1-111--------11----------------------------------11-11-------1-1--11------1--1111111111-1-111112---2111111-----131111111111111111111111-11111111112-1221111111112211122111111221111111111111311-----------------------------121211111112222221111122111111112211111-221112111211121122111111-------111111-1212221112222-1211222321111111-1--1-11111----------1111111111111212112111111111111112111---2221------1111111111111-111-1111111111111111111111111111111--1---11111121111111--111111111111---111111----11112-----------1---11111111111222221222122221111---------21112222222222222111111111111111-221111--------------------------------------1--1-111111 11----1-1---11111121111111111111111111111111111111111121111111111111-11-11121-1111111111-12111111111121212-12-2---------------------------------------------------133124113114-1222V1113262251442252112 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSAEGVGDGAGVSLDLSLSFFRELTGDAALPAGRFGVGNFFLPQNPAFHGEAVGIIGNAL:Sequence :ccTTcccccccEEEEccHHHHHHHHHHTTcccccEEEEEEEEccccHHHHHHHHHHHHHH:Sec Str : =======================================================:RP:SCP|6->371|1ea0A3|6e-37|28.6|360/419|d.153.1.1 : ======================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 61: . . . * . .: 120 :KEQGFSVLLVRDVPVNDTAIRPAAIPYQLPIRQWVFSAPVECATLAEFDWRIHKALLAIE:Sequence :HHTTcEEEEEEEccccGGGccHHHHHHccEEEEEEEEcTTcccHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|6->371|1ea0A3|6e-37|28.6|360/419|d.153.1.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 121: . . + . . .: 180 :ALAYTVPDLAGFYPLSLSARTQVLKGRLNSQEVMPYFCDLTDPRHKVHTMYFHTRFSTNT:Sequence :HHHHHTcccEEcEEEEEEccEEEccccccGGGHHHHcGGGGcTTccccEEEEEEcccccc:Sec Str :============================================================:RP:SCP|6->371|1ea0A3|6e-37|28.6|360/419|d.153.1.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|143->322|PF00310|1e-20|45.4|163/175|GATase_2 181: . * . . . .: 240 :DPHPSMAQPFRLMAHNGELNTDKKNRLSEAAVALAKNASIVRPKGQSDSCRLDQTLQARV:Sequence :ccccTTccccccEEEEEccTTHHHHccccTTGGGHHHHcccccTTccHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|6->371|1ea0A3|6e-37|28.6|360/419|d.153.1.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|143->322|PF00310|1e-20|45.4|163/175|GATase_2 241: + . . . . *: 300 :MEDGLDLVTAVVSMMPPAWENDDTLSPGVKSMLEYFSLYEEKNDGPAALIFGDGTIIGAR:Sequence :HTTTccHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccEEEEEccccEEEEE:Sec Str :============================================================:RP:SCP|6->371|1ea0A3|6e-37|28.6|360/419|d.153.1.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|143->322|PF00310|1e-20|45.4|163/175|GATase_2 301: . . . . + .: 360 :LDRLGLRPLRTVETDDYLCVMSEAGQIAFPAESVIRRGRIEAGGMLYYDHTERRAFSTVE:Sequence :ccTTcccccEEEEETTcEEEEcccTTccccGGGEEEEEEccTTcEEEEETTTTEEEcHHH:Sec Str :============================================================:RP:SCP|6->371|1ea0A3|6e-37|28.6|360/419|d.153.1.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|143->322|PF00310|1e-20|45.4|163/175|GATase_2 361: . . . * . .: 420 :ALELLASRRDYSSLLSDARVMLGDLPEVPADKQGSPLRYNGDLERHQRYVAYSHNQESFK:Sequence :HHHHHHHTTTHHHHHTTcccTTHHHHHHHHTTccccccTHHHHHHHHTTTTTHccHHHHH:Sec Str :=========== :RP:SCP|6->371|1ea0A3|6e-37|28.6|360/419|d.153.1.1 : ============================================:RP:SCP|377->747,938->1287|1ea0A2|4e-75|27.9|696/763|c.1.4.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 : $$$$$$$$$$$$$$:RP:PFM|407->680|PF04898|2e-37|33.5|269/288|Glu_syn_central 421: . . + . . .: 480 :FLMDPMLASGAEKISAMGYGNAINALSDQEGGVAKYFSQRFAQVTNPPLDSIREADGMTL:Sequence :TTTHHHHHHccccEEccccccccGGGccccccGGGTEEEcccccccccccTTTTGGGccc:Sec Str :============================================================:RP:SCP|377->747,938->1287|1ea0A2|4e-75|27.9|696/763|c.1.4.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|407->680|PF04898|2e-37|33.5|269/288|Glu_syn_central 481: . * . . . .: 540 :RVALGAKPNSGAKKARQIVVRSPILTHLDMLRIREQPETPVRRFEMLYTPVFDAEDANEA:Sequence :cEEEcccccTTcccGccEEEccccccHHHHHHHHHHHGGGEEEEEcEEEcTTcTTHHHHH:Sec Str :============================================================:RP:SCP|377->747,938->1287|1ea0A2|4e-75|27.9|696/763|c.1.4.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|407->680|PF04898|2e-37|33.5|269/288|Glu_syn_central 541: + . . . . *: 600 :ALRQAIDGLCGEVVAFAAEEGGIAVVTDRHVSAGRAALPMIMVVSAINQRLIEEGLRLRI:Sequence :HHHHHHHHccccccHHHHHHTcEEEEEcTTccTTEEEccHHHHHHHHHHHHHTTTcGGGc:Sec Str :============================================================:RP:SCP|377->747,938->1287|1ea0A2|4e-75|27.9|696/763|c.1.4.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|407->680|PF04898|2e-37|33.5|269/288|Glu_syn_central 601: . . . . + .: 660 :SLIVESGQFSSSHHIAAGLGFGASAVYPLGVQFRAEEKFGADADKAFKRFAKAAEKSLMK:Sequence :EEEEEccccccHHHHHHHHTTTccEEEcHHHHHHHHTTTTccHHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|637->656|ekfgadadkafkrfakaaek :============================================================:RP:SCP|377->747,938->1287|1ea0A2|4e-75|27.9|696/763|c.1.4.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|407->680|PF04898|2e-37|33.5|269/288|Glu_syn_central 661: . . . * . .: 720 :TMGKVGLCTAESYIGGEFFEPNFLDTSDPVLKRYFPNVKTPVGGVTFAVIAQAVADWHRK:Sequence :HHHTTTcccHHHHTTcccEEE EccccHHHHHHHccccccccccccHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|377->747,938->1287|1ea0A2|4e-75|27.9|696/763|c.1.4.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 :$$$$$$$$$$$$$$$$$$$$ :RP:PFM|407->680|PF04898|2e-37|33.5|269/288|Glu_syn_central 721: . . + . . .: 780 :ALSVKGENDIPLLGLFKERAEGAGHSYGTTAVRGFVDMTEEKIGFDKGTENEEALRLLPL:Sequence :HHc ccccccccccccccccccccccccHHHHHHHHHH HHHTcHHHHHHHH :Sec Str :=========================== :RP:SCP|377->747,938->1287|1ea0A2|4e-75|27.9|696/763|c.1.4.1 :================================ :BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 781: . * . . . .: 840 :NRLEDAFGLNDAAYYHNSFDRLTPDAIDAFEVTPGYRAFSRMMAEERARRPAALRDVLEL:Sequence : HHHHTcccccGGGGEEEccccccccGGGcccHHHHHTTE E:Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|817->835|rafsrmmaeerarrpaalr 841: + . . . . *: 900 :PADVTFAGSAEEFRREMGRFCRHGNNSFMVRGLRCDEAADGSFRLQLIGPHGHELARLAA:Sequence :EEEcccTTccHHHHHHHHHTTcEEEccTTcccccccTTcccccccEEEEccccTTccHHH:Sec Str 901: . . . . + .: 960 :LGQSLLDRFDDDIAGHWLEGGALMVQAKGEAFAYMSLIRTAPNSIPLETVQKASEITKTL:Sequence :HTcccEEEEEcccTTcTTTccEE cGGGGEEEccccccccGGGcccHcTTTTcc:Sec Str : =======================:RP:SCP|377->747,938->1287|1ea0A2|4e-75|27.9|696/763|c.1.4.1 : ================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|919->1253|PF01645|8e-76|48.3|331/342|Glu_synthase 961: . . . * . .:1020 :ASGAMSHGALVAAAHEAVAHGTNMVGGMSNSGEGGEHISRYGTIRASRIKQFASGRFGVW:Sequence :cccEEEcccTTTTccHHHHHHTTEEEEEEEEcTTcTTGGGcccccEEEEEEEETTccccE:Sec Str : XXXXXXXXXXXXXXX :SEG|967->981|hgalvaaaheavahg :============================================================:RP:SCP|377->747,938->1287|1ea0A2|4e-75|27.9|696/763|c.1.4.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|919->1253|PF01645|8e-76|48.3|331/342|Glu_synthase 1021: . . + . . .:1080 :AGYLADPMLEEIEIKIGQGAKPGEGGQLPSPKVTVEIAAARGGTPGVELVSPPPHHDTYS:Sequence :EEEEEEEEEEcccEEcTTcccEEcccccTTccccGGGcccEEcTTTTccEEcccEEEEEE:Sec Str :============================================================:RP:SCP|377->747,938->1287|1ea0A2|4e-75|27.9|696/763|c.1.4.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|919->1253|PF01645|8e-76|48.3|331/342|Glu_synthase 1081: . * . . . .:1140 :IEDLAQLIHDAKAARVRVIVKLVSSEGIGTIAVGVAKAGADVINVAGNTGGTGAAAVTSL:Sequence :cccccccHEEcccccTTEEccccTTccTTcEEEEcccTTEEEEccccccccTTcccEEcc:Sec Str : XXXXXXXXXXXXXXX :SEG|1124->1138|nvagntggtgaaavt :============================================================:RP:SCP|377->747,938->1287|1ea0A2|4e-75|27.9|696/763|c.1.4.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|919->1253|PF01645|8e-76|48.3|331/342|Glu_synthase 1141: + . . . . *:1200 :KYTGRAAEIGIAEVHQALCATGLRAKVLLRCSGAHQTASDVVKSALLGGDSFEFGTTALM:Sequence :cccccccHHHHHHHHHHHHHTTccEEcccEEEEccccHHHHHHHHHTTccEEEccHHHHH:Sec Str :============================================================:RP:SCP|377->747,938->1287|1ea0A2|4e-75|27.9|696/763|c.1.4.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|919->1253|PF01645|8e-76|48.3|331/342|Glu_synthase 1201: . . . . + .:1260 :MLKCVMAKNCNIKCPAGLTTNQEAFNGDPRALAQYLMNIAHETREILAGLGLRSLREARG:Sequence :HccccHHHHTTcEEEEEEEEEEcTEEccTTccTTTTEEHHHHHHHHHHHHHHHHHHHTTc:Sec Str :============================================================:RP:SCP|377->747,938->1287|1ea0A2|4e-75|27.9|696/763|c.1.4.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|919->1253|PF01645|8e-76|48.3|331/342|Glu_synthase 1261: . . . * . .:1320 :RSDLLHLLDHPASVGQLDLRAMLAVVEEVKIDNPVYMEKDFALDDAFIELVRSALVDSRR:Sequence :cEEEEccTTcHHHHHHHHHHHHHccccTTccccccGccEEEEcccccHHHHHHHHHcHHH:Sec Str :=========================== :RP:SCP|377->747,938->1287|1ea0A2|4e-75|27.9|696/763|c.1.4.1 : ===================:RP:SCP|1302->1582|1ea0A1|4e-55|34.9|252/270|b.80.4.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 1321: . . + . . .:1380 :ENIELGGNRFLNNCNKSVGGQLAVDIERMLNHELSDEQLDALPAVKRDSRGRRFLEAGSV:Sequence :HHHHHHHHHHHccTTTccHHHHHHHHHHHHccccccccEEEccTTTccccHHHcccEEEE:Sec Str :============================================================:RP:SCP|1302->1582|1ea0A1|4e-55|34.9|252/270|b.80.4.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 : $$$$$$$$$:RP:PFM|1372->1528|PF01493|4e-30|44.6|157/195|GXGXG 1381: . * . . . .:1440 :RIDTSGSAGQSFGAFCNDGMIMVHTGTCNDGVGKSACGGTIVVRSPGGGSKETGGNVLVG:Sequence :EEcHHHHHHTTcHHHHHHHTTccccccTTccEEcEEEEEcHHHHHHcTTcccccTTGGGG:Sec Str :============================================================:RP:SCP|1302->1582|1ea0A1|4e-55|34.9|252/270|b.80.4.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1372->1528|PF01493|4e-30|44.6|157/195|GXGXG 1441: + . . . . *:1500 :NFALFGATGGRTFVEGQAGDRFAVRNSGATAVVEGVGDFACEYMTNGAVLNLGSFGKGFG:Sequence :GGTTHHHHHHHHHHHHHHHTTcccEEEEEEEEEEEccccTTcccTTccEEEEccTTcHHH:Sec Str : XXXXXXXXXXX:SEG|1490->1506|lnlgsfgkgfgngmsgg :============================================================:RP:SCP|1302->1582|1ea0A1|4e-55|34.9|252/270|b.80.4.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1372->1528|PF01493|4e-30|44.6|157/195|GXGXG 1501: . . . . + .:1560 :NGMSGGFVYQYDPYGDLPKKVSHDSILLGSITGEDEQAAIHNQAVHQLLTLHVAETGSAK:Sequence :HHHHHHHHHGGGGcccEHHHHHHHEEEEEcccHHHHHHTTTccEcEEEEccEEEEccHHH:Sec Str :XXXXXX :SEG|1490->1506|lnlgsfgkgfgngmsgg :============================================================:RP:SCP|1302->1582|1ea0A1|4e-55|34.9|252/270|b.80.4.1 :============================================================:BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1372->1528|PF01493|4e-30|44.6|157/195|GXGXG 1561: . . . * . .:1620 :AAWLLENWESEQHNFAYGMPRALLLYQDSDEILKAKPRKELLEELASALAGYQLRKFKLA:Sequence :HHHHHHHHHHHcccEGcEEEEcGG :Sec Str : XXXXXXXXXXX :SEG|1600->1610|elleelasala :====================== :RP:SCP|1302->1582|1ea0A1|4e-55|34.9|252/270|b.80.4.1 :===================== :BL:SWS|7->752,945->1581|GLTA_BACSU|e-115|42.7|1328/1520 1621: . . + . . .:1680 :YRDRKAVLNGTVPGYGETDTEDMYALINNYTVLSMAQAIALQRLPMASGPSDPAIEKAVR:Sequence : :Sec Str 1681: . * . . . .:1740 :NLILTEDYALMQRLLKYAREALSDHSDQQLAVMIAAKRLDDYKQALARRNIWSVDSPGTY:Sequence : :Sec Str 1741: + . . . . *:1800 :GWIIQQNRKNIEKIGRLPGFEELFAARAIPDLATASSHSRAA :Sequence : :Sec Str