[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAK85965.2 atum0 gltB.1 "glutamate synthase large subunit"
MSAEGVGDGAGVSLDLSLSFFRELTGDAALPAGRFGVGNFFLPQNPAFHGEAVGIIGNAL
KEQGFSVLLVRDVPVNDTAIRPAAIPYQLPIRQWVFSAPVECATLAEFDWRIHKALLAIE
ALAYTVPDLAGFYPLSLSARTQVLKGRLNSQEVMPYFCDLTDPRHKVHTMYFHTRFSTNT
DPHPSMAQPFRLMAHNGELNTDKKNRLSEAAVALAKNASIVRPKGQSDSCRLDQTLQARV
MEDGLDLVTAVVSMMPPAWENDDTLSPGVKSMLEYFSLYEEKNDGPAALIFGDGTIIGAR
LDRLGLRPLRTVETDDYLCVMSEAGQIAFPAESVIRRGRIEAGGMLYYDHTERRAFSTVE
ALELLASRRDYSSLLSDARVMLGDLPEVPADKQGSPLRYNGDLERHQRYVAYSHNQESFK
FLMDPMLASGAEKISAMGYGNAINALSDQEGGVAKYFSQRFAQVTNPPLDSIREADGMTL
RVALGAKPNSGAKKARQIVVRSPILTHLDMLRIREQPETPVRRFEMLYTPVFDAEDANEA
ALRQAIDGLCGEVVAFAAEEGGIAVVTDRHVSAGRAALPMIMVVSAINQRLIEEGLRLRI
SLIVESGQFSSSHHIAAGLGFGASAVYPLGVQFRAEEKFGADADKAFKRFAKAAEKSLMK
TMGKVGLCTAESYIGGEFFEPNFLDTSDPVLKRYFPNVKTPVGGVTFAVIAQAVADWHRK
ALSVKGENDIPLLGLFKERAEGAGHSYGTTAVRGFVDMTEEKIGFDKGTENEEALRLLPL
NRLEDAFGLNDAAYYHNSFDRLTPDAIDAFEVTPGYRAFSRMMAEERARRPAALRDVLEL
PADVTFAGSAEEFRREMGRFCRHGNNSFMVRGLRCDEAADGSFRLQLIGPHGHELARLAA
LGQSLLDRFDDDIAGHWLEGGALMVQAKGEAFAYMSLIRTAPNSIPLETVQKASEITKTL
ASGAMSHGALVAAAHEAVAHGTNMVGGMSNSGEGGEHISRYGTIRASRIKQFASGRFGVW
AGYLADPMLEEIEIKIGQGAKPGEGGQLPSPKVTVEIAAARGGTPGVELVSPPPHHDTYS
IEDLAQLIHDAKAARVRVIVKLVSSEGIGTIAVGVAKAGADVINVAGNTGGTGAAAVTSL
KYTGRAAEIGIAEVHQALCATGLRAKVLLRCSGAHQTASDVVKSALLGGDSFEFGTTALM
MLKCVMAKNCNIKCPAGLTTNQEAFNGDPRALAQYLMNIAHETREILAGLGLRSLREARG
RSDLLHLLDHPASVGQLDLRAMLAVVEEVKIDNPVYMEKDFALDDAFIELVRSALVDSRR
ENIELGGNRFLNNCNKSVGGQLAVDIERMLNHELSDEQLDALPAVKRDSRGRRFLEAGSV
RIDTSGSAGQSFGAFCNDGMIMVHTGTCNDGVGKSACGGTIVVRSPGGGSKETGGNVLVG
NFALFGATGGRTFVEGQAGDRFAVRNSGATAVVEGVGDFACEYMTNGAVLNLGSFGKGFG
NGMSGGFVYQYDPYGDLPKKVSHDSILLGSITGEDEQAAIHNQAVHQLLTLHVAETGSAK
AAWLLENWESEQHNFAYGMPRALLLYQDSDEILKAKPRKELLEELASALAGYQLRKFKLA
YRDRKAVLNGTVPGYGETDTEDMYALINNYTVLSMAQAIALQRLPMASGPSDPAIEKAVR
NLILTEDYALMQRLLKYAREALSDHSDQQLAVMIAAKRLDDYKQALARRNIWSVDSPGTY
GWIIQQNRKNIEKIGRLPGFEELFAARAIPDLATASSHSRAA
//