[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:hemF"

hemF        "coproporphyrinogen III oxidase"
HEM6_AGRT5  "RecName: Full=Coproporphyrinogen-III oxidase, aerobic;         Short=Coproporphyrinogenase;         Short=Coprogen oxidase;         EC=1.3.3.3;"

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------111111111--------------1-----------111-------1111111111111111111112211111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1111-----111111111111111111111111-1111111111111111111111111111111111111111111111111111-1-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-------111111------------------------11111----------------------------1111-1111111-1111111111111111111---1111------11111111111111111-111111111111111111111111111111111111111111111111-1111111111111111--1111111111111111---------------111111111111111111111111111111111111111---111111111111111111111111111-------------------------------------------------------1- 11--111-31--11111111111111111111111111111211111111111111111111111111111111111--111111111-23111121111111222-12--121111-11111111111151-111111-11111111-11-11-1112111131111212--231222U2123231121213232224 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MERPILPKGLPEDIEDKKAVAQAWFQHLRDTIVASFETLEDELTGPLSDQEPGRFVQKDW:Sequence : cHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHTTcccccEEEEE:Sec Str : =================================================:RP:SCP|12->267|1tk1A|1e-52|35.1|211/219|d.248.1.1 :============================================================:BL:SWS|1->303|HEM6_AGRT5|e-177|100.0|303/303 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->302|PF01218|2e-61|49.2|264/294|Coprogen_oxidas 61: . . . * . .: 120 :LRDNGEGGGGKMSMMEGRVFEKVGVHTSTVYGEFSPEFRKQIPGAEEDPRFWASGLSLIA:Sequence :EcTTccEEEEEEEEcccccEEEEEEEEEEEcccccccETccccccTcccEEEEEEEEEEE:Sec Str : XXXXXXXXXXXXX :SEG|65->77|geggggkmsmmeg :============================================================:RP:SCP|12->267|1tk1A|1e-52|35.1|211/219|d.248.1.1 :============================================================:BL:SWS|1->303|HEM6_AGRT5|e-177|100.0|303/303 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->302|PF01218|2e-61|49.2|264/294|Coprogen_oxidas 121: . . + . . .: 180 :HPVNPNVPAVHMNTRMVVTTSHWFGGGADLTPVLGRRRTQQDPDTQLFHRAFEITCNRHP:Sequence :EEccTTccEEEEEEEEEEEEcEEEEEEEEEEcccccHHcccHHHHHHHHHHHHHHHGGGc:Sec Str :============================================================:RP:SCP|12->267|1tk1A|1e-52|35.1|211/219|d.248.1.1 :============================================================:BL:SWS|1->303|HEM6_AGRT5|e-177|100.0|303/303 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->302|PF01218|2e-61|49.2|264/294|Coprogen_oxidas 181: . * . . . .: 240 :IADYPRYKSWCDEYFFLKHRDEPRGTGGIFFDWLHPDEEKGGWDANFTFVQDVGRAFNLV:Sequence :TTHHHHHHHHHHHHcEEGGGTEEcccEEEEEEEEccEEccccHHHHHHHHHHHHHHHHHH:Sec Str : ######################### :PROS|188->212|PS01021|COPROGEN_OXIDASE|PDOC00783| :============================================================:RP:SCP|12->267|1tk1A|1e-52|35.1|211/219|d.248.1.1 :============================================================:BL:SWS|1->303|HEM6_AGRT5|e-177|100.0|303/303 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->302|PF01218|2e-61|49.2|264/294|Coprogen_oxidas 241: + . . . . *: 300 :YPKIVRANFNQNWTEEDRDEQLIRRGRYVEFNLLYDRGTIFGLKTGGNVESILSSLPPVV:Sequence :HHHHHHHHTTccccHHHHHHHHHHHHHHHHHHHHTcHHHHHHHHTTccHHHHGGGccccc:Sec Str :=========================== :RP:SCP|12->267|1tk1A|1e-52|35.1|211/219|d.248.1.1 :============================================================:BL:SWS|1->303|HEM6_AGRT5|e-177|100.0|303/303 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->302|PF01218|2e-61|49.2|264/294|Coprogen_oxidas 301: . . . . + .: 360 :RWP :Sequence :ccc :Sec Str :=== :BL:SWS|1->303|HEM6_AGRT5|e-177|100.0|303/303 :$$ :RP:PFM|19->302|PF01218|2e-61|49.2|264/294|Coprogen_oxidas