[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:metF.1"

metF        "methylenetetrahydrofolate reductase"
            ""

OrgPattern ------------------------1---1--------------------------------------- ----------------------------------------------1-------1----------11---------------2--------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------221---1-1-1-----11-1112111---------------------------------------------1-1-----------------------------------1----------1----------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------1111111111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGWSSFWDNSGADGDVVRSSNILAGWSIEVMPRTAAKIDDFRNILPDGTRVYIAHIDGTP:Sequence : EEEEccccHHHHHHHHHHHHTTcccEEEEccHHH:Sec Str : ==================================:RP:SCP|27->294|1b5tA|2e-31|18.6|253/275|c.1.23.1 61: . . . * . .: 120 :IADMVSTAKRLHDEGFPVMPHLPARGISGKNELEDWLKRYQGEAGVTQALLLGGGQKQPA:Sequence :HHHHHHHHHHHHHHcccEEEEEEcTTcc HHHHHHHHHHHHHTTccEE EEEcccccccH:Sec Str :============================================================:RP:SCP|27->294|1b5tA|2e-31|18.6|253/275|c.1.23.1 : =========:BL:SWS|112->269|MTHR_HUMAN|5e-05|29.5|129/656 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|65->233|PF02219|5e-08|29.9|154/284|MTHFR 121: . . + . . .: 180 :GSFSSSIDMIETGLFDKMGFTHLHLAGHPEGNRDIDSDGSSRGVDQALLWKQDFASRTDA:Sequence :HHHHHHHHHH cccEEEEEEcTTccTTcccHHHHH HHHHHHHHHTEEEEE:Sec Str :============================================================:RP:SCP|27->294|1b5tA|2e-31|18.6|253/275|c.1.23.1 :============================================================:BL:SWS|112->269|MTHR_HUMAN|5e-05|29.5|129/656 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|65->233|PF02219|5e-08|29.9|154/284|MTHFR 181: . * . . . .: 240 :RLALTTQFAFEAKVVIEWAKRIGNMGVTIPVHVGIAGPTKLQTLIKFAIACGVGPSLKVL:Sequence : EcccccHHHHHHHHHHHHHTTccccEEcEEcccccHHHHHHHHHHHTccccHHHH:Sec Str :============================================================:RP:SCP|27->294|1b5tA|2e-31|18.6|253/275|c.1.23.1 :============================================================:BL:SWS|112->269|MTHR_HUMAN|5e-05|29.5|129/656 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|65->233|PF02219|5e-08|29.9|154/284|MTHFR 241: + . . . . *: 300 :QKRALDLSRLFVPYEPTDFIAELIDHKAANPDSLIEHVHIFPLGGIKPSAEWMKKHASTG:Sequence :TTcTTcHHH HHHHHHHHHHHHHHHHHHTT ccEEEEEcTTccHHHHHHHH :Sec Str :====================================================== :RP:SCP|27->294|1b5tA|2e-31|18.6|253/275|c.1.23.1 :============================= :BL:SWS|112->269|MTHR_HUMAN|5e-05|29.5|129/656 301: . . . . + .: 360 :TLANVA :Sequence : :Sec Str