[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:murG"

murG        "UDP-N-acetylglucosamine--N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase"
MURG_AGRT5  "RecName: Full=UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase;         EC=2.4.1.227;AltName: Full=Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase;"

OrgPattern -------------------------------------------------------------------- 111-1111111111-11----11111-----111-1-1--11131--11-1-11----112211111112111111111111-11111111111111--111111111111111111111111111111111111111-11---1-111111111--11111111111111111111111111111--11111122222322132233211111123311111111111111-1111111111111111111111111111111111111111111111---1111111----111-1-1111111111111--11---111111111111111111111111111111111111111111111111111111-1-111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111--------1111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111----1111111111111111111111111111111111111111111111111111111111111111111111111111-1--11111111111111111---1-----1---------------------------111-1-111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1---18-----1--1-12------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNKGIVLLAAGGTGGHVFPAEALAHTLKARGYQVHLVTDSRAERYAGKFPADEIHVVPSA:Sequence :ccccEEEEEccccTTccHHHHHHHHHHHHTTcEEEEEEcccHHHHHTHHHHHHcTTTTTT:Sec Str : =======================================================:RP:SCP|6->287|1f0kA|4e-53|33.3|273/351|c.87.1.2 :============================================================:BL:SWS|1->378|MURG_AGRT5|0.0|100.0|378/378 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->134|PF03033|1e-21|45.2|126/138|Glyco_transf_28 61: . . . * . .: 120 :TIGSKNPISVVRSLWKLWVGLRTARRLVTKLKPVAVVGFGGYPTVPPLLASTGLGVPSII:Sequence :GGGcccGGGGHHHHHHHHGGGHHHHHHHHHHcccEEEEETTcHHHHHHHHHHTccEEEEc:Sec Str :============================================================:RP:SCP|6->287|1f0kA|4e-53|33.3|273/351|c.87.1.2 :============================================================:BL:SWS|1->378|MURG_AGRT5|0.0|100.0|378/378 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->134|PF03033|1e-21|45.2|126/138|Glyco_transf_28 121: . . + . . .: 180 :HEQNAVMGRANKALAARVKAIAGGFLPPANGQYSEKTVATGNPVRPAVLAASEIPYTPSQ:Sequence :ccccccTTHHHHHTTcHHHHHTTcccccccGGGcccccTTEEEccccccccccccccccc:Sec Str :============================================================:RP:SCP|6->287|1f0kA|4e-53|33.3|273/351|c.87.1.2 :============================================================:BL:SWS|1->378|MURG_AGRT5|0.0|100.0|378/378 :$$$$$$$$$$$$$$ :RP:PFM|6->134|PF03033|1e-21|45.2|126/138|Glyco_transf_28 181: . * . . . .: 240 :TGETFQLVVFGGSQGAQFFSSAVPAAICLMKDEQRKRIVVTQQARPEDKDSVIASYQKLG:Sequence :cccccEEEEEcHHHHHHHccGGGHHHHHHHTTcccEEEEEcTTcccGGGccHHHHHHTTc:Sec Str :============================================================:RP:SCP|6->287|1f0kA|4e-53|33.3|273/351|c.87.1.2 :============================================================:BL:SWS|1->378|MURG_AGRT5|0.0|100.0|378/378 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|186->334|PF04101|3e-20|36.3|146/162|Glyco_tran_28_C 241: + . . . . *: 300 :VKADVSPFFGDMASRIGEADLVISRSGASTVSELSVIGRPSILVPYPHALDHDQAANAAA:Sequence :ccTTEEEcccccHHHHHTTEEEEEcccHHHHHHHHTHTccEEEcccT :Sec Str : XXXXXXXXXXXXX:SEG|288->308|haldhdqaanaaalsaaggas :=============================================== :RP:SCP|6->287|1f0kA|4e-53|33.3|273/351|c.87.1.2 :============================================================:BL:SWS|1->378|MURG_AGRT5|0.0|100.0|378/378 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|186->334|PF04101|3e-20|36.3|146/162|Glyco_tran_28_C 301: . . . . + .: 360 :LSAAGGASVIKQAELSPQKLSSLLSSALAEPDRLSATAAAAKATGKPHAADVLADLVEAI:Sequence : :Sec Str :XXXXXXXX :SEG|288->308|haldhdqaanaaalsaaggas : XXXXXXXXXX :SEG|320->329|lssllssala : XXXXXXXXXXXXXXX :SEG|336->350|ataaaakatgkphaa :============================================================:BL:SWS|1->378|MURG_AGRT5|0.0|100.0|378/378 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|186->334|PF04101|3e-20|36.3|146/162|Glyco_tran_28_C 361: . . . * . .: 420 :AEGRSVQEFKKKNEGVGA :Sequence : :Sec Str :================== :BL:SWS|1->378|MURG_AGRT5|0.0|100.0|378/378