[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:nouD"

nouD        "NADH ubiquinone oxidoreductase chain D"
NUOD_AGRT5  "RecName: Full=NADH-quinone oxidoreductase subunit D;         EC=1.6.99.5;AltName: Full=NADH dehydrogenase I subunit D;AltName: Full=NDH-1 subunit D;"

OrgPattern 11313121111111113112222121121311212222222222122411223132242531111-11 22213---------12122-21--21212221111111112111-1--1-----------22122112221--------21112322311111---1--1-11--22211--------------1111111111212223333331111111111111111111112111111111111111111111--1-1-111111111111111------111111----------1-------------------------------------------------------------------------------------------1---1----------2-------1-1--2--112221----22--211--23-111111111312112112533311111111111-11111111111111112222212222111111222211111111111322-12231111111111111111111111111111111111-111111111111111111121111111111111111111111111231111111111111111111121111-1-2---342223-433243418333313-2122211111111111111111231222221---------------------1----11--211111111122222213332322233-3333322333323333333222211122222222222222222233332231-21111111111111111111111112--1-----1----------11111111111-1111111111111-1111111111111--------------12111111111111112-111111------------------------------------121111-11-251 ------1-----11111111111111111111111111111111111111111111111111111----1--111------11111---12111251111111112-11-222112-1111111221212B1-1121111111111111-111111-111211116222121232111--------1131-2------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTEHNVRNFTINFGPEHPSAHGVLRLVLELDGEIVERVDPHIGLLHRGTEKLIETKTYLQ:Sequence : cccccccEEEEEcccccHccccEEEEEEEETTEEEEEEEETEcccccHHHHHTTccGGG:Sec Str : ############ :PROS|45->56|PS00535|COMPLEX1_49K|PDOC00521| : ===========================================:RP:SCP|18->396|2fug41|e-121|46.2|370/370|e.18.1.2 :============================================================:BL:SWS|1->396|NUOD_AGRT5|0.0|100.0|396/396 61: . . . * . .: 120 :AVPYFDRLDYVAPMNQEHAFALAVEKLLGLEIPMRGQLIRVLYSEIGRILSHIMNVTTQA:Sequence :HHHHHHTTccTTTTHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHHHHHHHHTG:Sec Str :============================================================:RP:SCP|18->396|2fug41|e-121|46.2|370/370|e.18.1.2 :============================================================:BL:SWS|1->396|NUOD_AGRT5|0.0|100.0|396/396 121: . . + . . .: 180 :MDVGAMTPPVWGFEEREKLMVFYERACGARMHSAYVRPGGVHQDLPPELVDDIGKWCDPF:Sequence :GGTccTGGGGGcHHHHHHHHHHHHTcccGGGTTcTTTTccTTccccHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|18->396|2fug41|e-121|46.2|370/370|e.18.1.2 :============================================================:BL:SWS|1->396|NUOD_AGRT5|0.0|100.0|396/396 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|122->396|PF00346|3e-92|62.6|254/254|Complex1_49kDa 181: . * . . . .: 240 :LTVLDNIEGLLTDNRIYKQRNVDIGVVSLEDAFAWGFTGVMVRGSGAAWDLRRSQPYECY:Sequence :HHHHHHHHHHHHccccccccEEETTEEccGGGGcHHHHHHHHHHHHHHHHHHHHTHHHHH:Sec Str :============================================================:RP:SCP|18->396|2fug41|e-121|46.2|370/370|e.18.1.2 :============================================================:BL:SWS|1->396|NUOD_AGRT5|0.0|100.0|396/396 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|122->396|PF00346|3e-92|62.6|254/254|Complex1_49kDa 241: + . . . . *: 300 :SDLEFDIPVGKNGDCYDRYLIRMQEMRESVKIMKQCVDRLSGKHRIGPVSSLDGKVVPPK:Sequence :HHHHHTGGGGGccccccEEEccEEEcccccHHHHHHHEEEcc EEEcTTcTTccccc:Sec Str :============================================================:RP:SCP|18->396|2fug41|e-121|46.2|370/370|e.18.1.2 :============================================================:BL:SWS|1->396|NUOD_AGRT5|0.0|100.0|396/396 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|122->396|PF00346|3e-92|62.6|254/254|Complex1_49kDa 301: . . . . + .: 360 :RGEMKRSMEALIHHFKLYTEGYHVPAGEVYAAVEAPKGEFGVYVVADGSNKPYRCKIRAP:Sequence :HccGGGEEEEcTTccccTTcTTccGGcccGGcccccccccTTcTTccccccEEEETTccc:Sec Str :============================================================:RP:SCP|18->396|2fug41|e-121|46.2|370/370|e.18.1.2 :============================================================:BL:SWS|1->396|NUOD_AGRT5|0.0|100.0|396/396 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|122->396|PF00346|3e-92|62.6|254/254|Complex1_49kDa 361: . . . * . .: 420 :GYAHLQAMDFLCKGHQLADVTAVLGSLDIVFGEVDR :Sequence :cccHHHHHHHHHcHHHHHHHHHHHHHTTccGGGcHH :Sec Str : ########## :PROS|383->392|PS00503|PECTINESTERASE_2|PDOC00413| :==================================== :RP:SCP|18->396|2fug41|e-121|46.2|370/370|e.18.1.2 :==================================== :BL:SWS|1->396|NUOD_AGRT5|0.0|100.0|396/396 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|122->396|PF00346|3e-92|62.6|254/254|Complex1_49kDa