[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:ohr"

ohr         "organic hydroperoxide resistance protein"
            ""

OrgPattern -------------------------------------------------------------------- 1---1--11111111------1---1------12221311-1111---222-111122-----11-1232-----------------------------111-1-2---1----------------------------------1--------------------------------------111-------211111111-1111111-2222111-1-122111111111111111111111111-22121----------------1----1-------------------------------------------------------------------------------------------------1--311-------141211221-1-11111111111-11111111-21-2111434453221111---1-----11--------1-1-1121--------------------------------1111---16444363111133451111-14223251--3321112212113--2-----2------------1---------------------------1-11-----------------------------11-1--12111-111121-111111-1111--------------212-11---------------------------------11-------------------1---------1--------------------1111--1-1---1-1---------11111-11211-11111161111111111-----------111111111111111111111111111-------------------------1------1-------1----------------1- ----2-------11-1-11-------------------------------11-1-----------------------------------142-121----1------------------------------------------------------------------------------------1------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPILYTTKASATGGRAGNAKSEDGVLDVTLTVPKELGGDGARGTNPEQLFAAGYSACFLG:Sequence :ccccccccEEEEcGGGcEEEETTcccEEEcccTTTTTTTccTcccHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|1->140|1n2fA|3e-37|59.4|138/142|d.227.1.1 : ==========================================================:BL:SWS|3->139|Y3023_ACIAD|4e-41|60.4|134/143 : $$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|38->138|PF02566|1e-09|40.4|99/99|OsmC 61: . . . * . .: 120 :ALKAVAGKHKVKIPEDTTVTATVGIGPREDGTGFGIEVTLKVNIPGLEREKAEELVAAAH:Sequence :HHHHHHHTTTcccccEEEEEEEEEEETccTTTEEEEEEEEEEEcTTccHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|1->140|1n2fA|3e-37|59.4|138/142|d.227.1.1 :============================================================:BL:SWS|3->139|Y3023_ACIAD|4e-41|60.4|134/143 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|38->138|PF02566|1e-09|40.4|99/99|OsmC 121: . . + . . .: 180 :IVCPYSHAMRTSTEVPVSVA :Sequence :HHcHHHHHHTTTcccEEEEE :Sec Str :==================== :RP:SCP|1->140|1n2fA|3e-37|59.4|138/142|d.227.1.1 :=================== :BL:SWS|3->139|Y3023_ACIAD|4e-41|60.4|134/143 :$$$$$$$$$$$$$$$$$$ :RP:PFM|38->138|PF02566|1e-09|40.4|99/99|OsmC