[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAK86654.1 atum0 ohr "organic hydroperoxide resistance protein"
MPILYTTKASATGGRAGNAKSEDGVLDVTLTVPKELGGDGARGTNPEQLFAAGYSACFLG
ALKAVAGKHKVKIPEDTTVTATVGIGPREDGTGFGIEVTLKVNIPGLEREKAEELVAAAH
IVCPYSHAMRTSTEVPVSVA
//