[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:ordL.3"

ordL        "oxidoreductase"
            ""

OrgPattern -------------------------------------------------------------------- -1-12---------2------2---2------22221-341--1--------1--1-----24---12122-----------1-------------------------1---------------------------1--12----1-------11-----------------------------1-------1------------------------1------1-------1----------------------------------------------------------------------------------------------------------1-----------1------------------------211111111--32311-3123122222222228---2--5-2362-77745584566732---2345434436--------111---12-----------------------------2-331--7642889B9B4111199B73333-3C78253---112111--114234-------111111111--1-1--1---------------------------1-----------------------------32-1--31---4333323344434434344--------------1-1---111-1---11-11111--1111-111111-2221122-111111111111111121111111-----------------1------------45----11-111-1--132412-1-1-21AA8B99985AB883534-------------------121111111111111-------------------------------------------------------------1- ---------------1-2-----11--------11---------------1111-------------------------------------------------------------------------------------------------------------3------------------------21--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MYNDPRSHGLWEKTAPQPPVTPALQGDAVADVVVVGGGFTGQSAALHLAEGGLDVILLEA:Sequence : HHHHHHHHHHHHTTccEEEEcc:Sec Str : XXXXXXXXXXXXX :SEG|26->38|gdavadvvvvggg : ====================:RP:SCP|41->307|1ng3A1|1e-25|16.7|257/276|c.3.1.2 : ==================================================:BL:SWS|11->393|ORDL_RHIME|3e-41|30.7|378/428 : $$$$$$$$$$$$$$$$$$$$:RP:PFM|41->381|PF01266|2e-16|29.4|330/354|DAO 61: . . . * . .: 120 :KEIGFGGAGRNVGLINGGMWVMPKELPDVLGETYGERLLDLLGDAPVLVRELVEKHGIPC:Sequence :cccccccccccccEEEEccccTTcTTHHHHHHHHHHHHHHHHHHcccccEEHHHHHTccE:Sec Str :============================================================:RP:SCP|41->307|1ng3A1|1e-25|16.7|257/276|c.3.1.2 :============================================================:BL:SWS|11->393|ORDL_RHIME|3e-41|30.7|378/428 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|41->381|PF01266|2e-16|29.4|330/354|DAO 121: . . + . . .: 180 :EIEKNGTLHCAVGEKGLAEIRERCEQWSARGAPVRVLDADETASYIGSTAYSGALLDSRA:Sequence :EEEccccEEEEEETTccHHHHHHHHHHHHHTcccEEEETHHHHTTccccTTEEEEEETTc:Sec Str :============================================================:RP:SCP|41->307|1ng3A1|1e-25|16.7|257/276|c.3.1.2 :============================================================:BL:SWS|11->393|ORDL_RHIME|3e-41|30.7|378/428 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|41->381|PF01266|2e-16|29.4|330/354|DAO 181: . * . . . .: 240 :GTIQPLAYVRGLAGAALKAGVRLHTASPVNETGRNGAKWVVKTPEGSVTAKWIVVATEAY:Sequence :EEEEHHHHHHHHHHHHHHTTcEEEccccEEEEcccTTcEEEEETTEEEEEEEEEEccGGG:Sec Str :============================================================:RP:SCP|41->307|1ng3A1|1e-25|16.7|257/276|c.3.1.2 :============================================================:BL:SWS|11->393|ORDL_RHIME|3e-41|30.7|378/428 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|41->381|PF01266|2e-16|29.4|330/354|DAO 241: + . . . . *: 300 :STGPWQIIREEQVYLPYFNFATRPLSDNLQKSILPGRQGCWDTKEILSSFRMDKAGRLVF:Sequence :HHGGGGTEEcccEEEEEEEEEEcccHHHHcGGGTccEEEEEETTEEEEEEcccTTccEEE:Sec Str :============================================================:RP:SCP|41->307|1ng3A1|1e-25|16.7|257/276|c.3.1.2 :============================================================:BL:SWS|11->393|ORDL_RHIME|3e-41|30.7|378/428 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|41->381|PF01266|2e-16|29.4|330/354|DAO 301: . . . . + .: 360 :GSVGALRGTGTAIHRAWAKRSLKRLFPQLGDTEFECEWYGQIGMTDNAVPRFHKFAENVI:Sequence :EEccccEETccTHHHHHHHHHHHHHcGGGccccEEEEEEEEEEEcTTcccEEEEETTEEE:Sec Str :======= :RP:SCP|41->307|1ng3A1|1e-25|16.7|257/276|c.3.1.2 :============================================================:BL:SWS|11->393|ORDL_RHIME|3e-41|30.7|378/428 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|41->381|PF01266|2e-16|29.4|330/354|DAO 361: . . . * . .: 420 :GFSGYNGRGIAPGTAFGKVIAQHILGEIAEADLPLPVTEPKAQAFRAVKEAYYEAGAQIA:Sequence :EEEccTTccGGGHHHHHHHHHHHHHHcccccccGHcccGGHHHHHHHHHHHTcccTTccc:Sec Str :================================= :BL:SWS|11->393|ORDL_RHIME|3e-41|30.7|378/428 :$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|41->381|PF01266|2e-16|29.4|330/354|DAO 421: . . + . . .: 480 :HFAGERF :Sequence :EGG :Sec Str