[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:phnG"

phnG        "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------1----------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---11111----------1---1--1-1-3--11111111111111-----1----111--------1------------------------------------------------------1111--11111-1---11111---------1---111-------11-------------------11-------------------------------------------------11-------------------------------------------1-11-1-1111111111-111111111111111111-11112----1--------------111----1--1111111-1111---------------------------------------------1111---11-----111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNNEAANIDSERKRVAALLARATVQELETVWSRQDASPQTENVRGPETGLVMVKGRIGGG:Sequence : TEEEEEEcccccTT GGGcccccccEEEEE :Sec Str : ===================================================:BL:SWS|10->153|PHNG_RHIME|4e-42|58.7|143/156 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->152|PF06754|1e-29|48.6|146/146|PhnG 61: . . . * . .: 120 :GAPFNLGETTVTRATVKLASGTVGHAHVLGTGRKKAWYAAVFDALWQESQTRGFIEAELL:Sequence : EEcccccEEcccccTcHHHHHHHHHHHTcGGGccTTcHHHHHHHHHHHTTcTTHHHT:Sec Str :============================================================:BL:SWS|10->153|PHNG_RHIME|4e-42|58.7|143/156 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->152|PF06754|1e-29|48.6|146/146|PhnG 121: . . + . . .: 180 :SPVEKRLSEEKQRKTKETAATRVDFFTMVRGED :Sequence :ccccccHHHHHHHHHHHTcHHHHHcHHHHHHH :Sec Str :================================= :BL:SWS|10->153|PHNG_RHIME|4e-42|58.7|143/156 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|7->152|PF06754|1e-29|48.6|146/146|PhnG