[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAK86001.1 atum0 phnG "conserved hypothetical protein"
MNNEAANIDSERKRVAALLARATVQELETVWSRQDASPQTENVRGPETGLVMVKGRIGGG
GAPFNLGETTVTRATVKLASGTVGHAHVLGTGRKKAWYAAVFDALWQESQTRGFIEAELL
SPVEKRLSEEKQRKTKETAATRVDFFTMVRGED
//