[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:rbsK"

rbsK        "ribokinase"
            ""

OrgPattern ------12111111111--111------1--------------------------------------- 1-1--11122211112211-11---111111-1111111122--131----1212--1--1122-221131111121211--2-------2--1-----1---11--1-1--------------------------12211----1-11----11-----------11111------------212-----2111111111111111113111111111111111------13111111111111111111112211111311123221111212222111111-1------------------------------------1----2111111121111--111112-11---1----1--21--221-1-1--1111--------212--1-----1111111-112---2--1--14--233422244311--11-2323132421--------11111-11----------------------------------------2333322----2224222212323------111--1----1-12----1--11--------------1--1-----1------------------11----------------------------1231----2-1-111111111111121121-------------22121211114124312-121123213413111111232311114534455555564544612211111--322222211222-------------1-111222113-11112221------1-----11111222-1111-1131----1----1111222221111211-1111111-------1----------------1----1---------------------111--31112-- -----11-2111111111112222122--111111111-1111---1111222222121-1111111111111111111111111111----1111111-1111-1-1612111111111111111-11261-112---12111-111-11111-111111-1113131111121-111-21-2122311121132121 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MITVFGSINMDLVATAKRLPKPGETVTGDTFSTAAGGKGANQALAARRAGVTVKMAGATG:Sequence :cEEEEcccEEEEEEEcccccccccccccccccEEEEcHHHHHHHHHHHTTcEEEEEcEEc:Sec Str : ===========================================================:RP:SCP|2->299|2fv7A1|2e-55|30.9|298/308|c.72.1.1 : ===========================================================:BL:SWS|2->299|RBSK_ECOLI|3e-41|33.2|298/309 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->286|PF00294|1e-19|37.2|277/295|PfkB 61: . . . * . .: 120 :DDTFAAPALTLLRDAGTDLSLVKTAPGPTGTAVILIGEGGENMISVIPAANGEVSAFDAT:Sequence :TTTTTcHHHHHHHHTTcccTTcEEccccccEEEEEEcTTccEEEEEEcGGGGGGGGGGcc:Sec Str :============================================================:RP:SCP|2->299|2fv7A1|2e-55|30.9|298/308|c.72.1.1 :============================================================:BL:SWS|2->299|RBSK_ECOLI|3e-41|33.2|298/309 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->286|PF00294|1e-19|37.2|277/295|PfkB 121: . . + . . .: 180 :KVVGEMDAGDILMLQFEIPAAAIEAALTAAKAKRITTVINTAPLTADGPRLAGLADIVIA:Sequence :cccccEEEEEEEcccHHHHHHHHHHHcTTcEEEEEcGGGGGGccHHHHHHHHTTccEEEE:Sec Str : XXXXXXXXXXXXX :SEG|140->152|aaaieaaltaaka :============================================================:RP:SCP|2->299|2fv7A1|2e-55|30.9|298/308|c.72.1.1 :============================================================:BL:SWS|2->299|RBSK_ECOLI|3e-41|33.2|298/309 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->286|PF00294|1e-19|37.2|277/295|PfkB 181: . * . . . .: 240 :NETEFELLIGKNGLSSGERESELKALHDRTGQTLIVTLGADGVIAMRNGKVFSASGLKIE:Sequence :cHHHHHHHHHccccccHHHHTccHHHHHTTccEEEEEcGGGcEEEEcccEEEEccccccc:Sec Str :============================================================:RP:SCP|2->299|2fv7A1|2e-55|30.9|298/308|c.72.1.1 :============================================================:BL:SWS|2->299|RBSK_ECOLI|3e-41|33.2|298/309 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->286|PF00294|1e-19|37.2|277/295|PfkB 241: + . . . . *: 300 :PVDTVGAGDTFCGYLAASLDQGMDFEKALKRAAVAGSLACTRAGAQPSIPQAAEVDAAL :Sequence :ccccTTHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHTTcccccTTcccHHHHHHHH :Sec Str :=========================================================== :RP:SCP|2->299|2fv7A1|2e-55|30.9|298/308|c.72.1.1 :=========================================================== :BL:SWS|2->299|RBSK_ECOLI|3e-41|33.2|298/309 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->286|PF00294|1e-19|37.2|277/295|PfkB