[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:tyrS"

tyrS        "tyrosyl-tRNA synthetase"
SYY_AGRT5   "RecName: Full=Tyrosyl-tRNA synthetase;         EC=6.1.1.1;AltName: Full=Tyrosine--tRNA ligase;         Short=TyrRS;"

OrgPattern -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111211111111111111111111111111111111111111111111111111111121112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122222222122222211221222211121111111111111111111111111111111212111111111111111111111111111111111111111111111111111111111111221111111122222222222211221111211111111122111111111111111111111111111111111111111111111111111-111111111111111111121111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111112111111111111111111111-111111111111111111111111-111-11111111111111111111111222111111111111111111111111111111111111111111111111111111111111111111-11111111111111111222211111111111111111111111111122222221221111111-11111111111111111111111111111111-11111111111111111111111111111111 11--111-1-----111111111111111111111111-21111111111111111111111111111-1111111112111111111-11-11111111111111-121211111-11-11111111-151-11111111111-111--11141111212111111111612221111A1111111121111111211 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSRFKSDFLRTLDERGFIHQISDEAGLDELFAKETVTAYIGYDPTASSLHVGHLTQIMML:Sequence :HHHHHTccccHHHHTTcEEEEEcHHHHHHHHHTTcEEEEEEEccccccccHHHHHHHHHH:Sec Str : =======================================================:RP:SCP|6->312|1jiiA|e-108|44.4|304/319|c.26.1.1 :============================================================:BL:SWS|1->417|SYY_AGRT5|0.0|100.0|417/417 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|33->312|PF00579|1e-25|33.7|261/279|tRNA-synt_1b 61: . . . * . .: 120 :HWMQKTGHQPISLMGGGTGMVGDPSFKEEARKLMTIDMIEDNITSLKHVFANYLDYDRAE:Sequence :HHHHHHHTccEEEEcHHEEEcHHHHHHcHHHccccHHHHHHHHHHTHHHHHHHHTTTccT:Sec Str :============================================================:RP:SCP|6->312|1jiiA|e-108|44.4|304/319|c.26.1.1 :============================================================:BL:SWS|1->417|SYY_AGRT5|0.0|100.0|417/417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|33->312|PF00579|1e-25|33.7|261/279|tRNA-synt_1b 121: . . + . . .: 180 :NPALMINNADWLRGLNYLEFLRDVGRHFSVNRMLSFDSVKTRLDREQSLSFLEFNYMILQ:Sequence :TcEEEEEHHHHHTTccHHHHHHHHHHTccHHHHccHHHHHHHHcccTTccHHHHTHHHHH:Sec Str :============================================================:RP:SCP|6->312|1jiiA|e-108|44.4|304/319|c.26.1.1 :============================================================:BL:SWS|1->417|SYY_AGRT5|0.0|100.0|417/417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|33->312|PF00579|1e-25|33.7|261/279|tRNA-synt_1b 181: . * . . . .: 240 :AYDFVELNQRTGCRLQMGGSDQWGNIINGIDLGHRMGTPQLYALTSPLLTTSSGAKMGKS:Sequence :HGGGHHTTccccEEEEEEEGGGHHHHHHHHHHHHHTTccccEEEEEccTTcccccccTTc:Sec Str : XXXXXXXXX:SEG|232->244|ssgakmgksasga :============================================================:RP:SCP|6->312|1jiiA|e-108|44.4|304/319|c.26.1.1 :============================================================:BL:SWS|1->417|SYY_AGRT5|0.0|100.0|417/417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|33->312|PF00579|1e-25|33.7|261/279|tRNA-synt_1b 241: + . . . . *: 300 :ASGAVWLNKDLLPVYDFWQYWRNTEDADVVRFAKLFTTLPMDEIARIATLGGSEINEAKK:Sequence :GGGcccTTcccccHHHHHHHcccTTTTcHHHHHHHHHcccHHHHHHHHHHccccHHHHHH:Sec Str :XXXX :SEG|232->244|ssgakmgksasga :============================================================:RP:SCP|6->312|1jiiA|e-108|44.4|304/319|c.26.1.1 :============================================================:BL:SWS|1->417|SYY_AGRT5|0.0|100.0|417/417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|33->312|PF00579|1e-25|33.7|261/279|tRNA-synt_1b 301: . . . . + .: 360 :ILATEVTAILHGRAAAEEAAETARKTFEEGALAENLPSIEVPTSELDAGVGVLSLIVRAG:Sequence :HHHHHHHHHHHHTccHHHHHHHHHHTTTcHHHccccTTTTTHHHTHHHHccTTTTTTTTT:Sec Str : XXXXXXXXXXXXXXXXX :SEG|313->329|raaaeeaaetarktfee :============ :RP:SCP|6->312|1jiiA|e-108|44.4|304/319|c.26.1.1 : ===========================:RP:SCP|334->417|1h3eA2|2e-08|31.6|79/81|d.66.1.4 :============================================================:BL:SWS|1->417|SYY_AGRT5|0.0|100.0|417/417 :$$$$$$$$$$$$ :RP:PFM|33->312|PF00579|1e-25|33.7|261/279|tRNA-synt_1b 361: . . . * . .: 420 :LASSNGEARRHVQGGAVKINEQGVSDERQIIGTGEVTGDGVIKLSVGKKKHVLVRPA :Sequence :cccccHHHHHHHHTTcEEETTEEcccTTccccTTEEEEccccccccccEEEEEEEcc :Sec Str :========================================================= :RP:SCP|334->417|1h3eA2|2e-08|31.6|79/81|d.66.1.4 :========================================================= :BL:SWS|1->417|SYY_AGRT5|0.0|100.0|417/417