[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "atum0:uppS"

uppS        "undecaprenyl pyrophosphate synthase"
UPPS_AGRT5  "RecName: Full=Undecaprenyl pyrophosphate synthetase;         Short=UPP synthetase;         EC=2.5.1.31;AltName: Full=Di-trans,poly-cis-decaprenylcistransferase;AltName: Full=Undecaprenyl diphosphate synthase;         Short=UDS;"

OrgPattern 11111111111111111111111112222221111111111111122221332111111111111-11 1221222222222222222-22223222222322222222222223222222222222222222222233211111111111111111111111111--11111111111111111111111111111111111111111111111221111111111111111111222111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122212222232222122212221211111111111211212111111112111111-----112221111122111111111111-222222211111111111111111111111111111111111111112111111111------111111111111111111111111111111111112111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111121111-1111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------------1------1111111111111 1--1111-21111111111111111211111112121111111111111111111111111121222212222222222222222211-12-1213111112111111412111111111-11155141CG2-411111121121111111111111122111111-121111112222F2222133271992232222 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPTTTRSSIPEHVAIIMDGNGRWAKQRGLPRVMGHRRGVEAVRETVRAAGDCGISYLTLF:Sequence :HHHHcTcccccEEEEEEccHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHTTccEEEEE:Sec Str : =======================================================:RP:SCP|6->232|1jp3A|7e-79|44.1|213/214|c.101.1.1 :============================================================:BL:SWS|1->247|UPPS_AGRT5|e-140|100.0|247/247 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->236|PF01255|7e-65|52.9|221/222|Prenyltransf 61: . . . * . .: 120 :AFSSENWRRPESEVSDLMGLLKAFIRRDLAELHRENVRVRIIGDRQGLKTDIRSLLEEAE:Sequence :EccccGGGccHHHHHHHHHHHHHHTTTHHHHHHHTTcEEEEEcccTTccHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|6->232|1jp3A|7e-79|44.1|213/214|c.101.1.1 :============================================================:BL:SWS|1->247|UPPS_AGRT5|e-140|100.0|247/247 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->236|PF01255|7e-65|52.9|221/222|Prenyltransf 121: . . + . . .: 180 :QMTAGNTKLTLVIAFNYGSRDEITRATASIARDVAEGRLSADAITPEMISSRLDTSGMPD:Sequence :HHHTTccccEEEEEccccHHHHHHHHHHHHHHHHHHTcccGGGccHHHHHTTcTTTTccc:Sec Str :============================================================:RP:SCP|6->232|1jp3A|7e-79|44.1|213/214|c.101.1.1 :============================================================:BL:SWS|1->247|UPPS_AGRT5|e-140|100.0|247/247 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->236|PF01255|7e-65|52.9|221/222|Prenyltransf 181: . * . . . .: 240 :PDLIIRTSGEERLSNFLLWQAAYSEFLFVPEYWPDFDRQRFFSAIEQYATRDRRFGALAE:Sequence :ccEEEEcccccccTTcccGGGTTcEEEEccccGGGccHHHHHHHHHHHHHHccHcTc :Sec Str : ################## :PROS|182->199|PS01066|UPP_SYNTHETASE|PDOC00817| :==================================================== :RP:SCP|6->232|1jp3A|7e-79|44.1|213/214|c.101.1.1 :============================================================:BL:SWS|1->247|UPPS_AGRT5|e-140|100.0|247/247 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|16->236|PF01255|7e-65|52.9|221/222|Prenyltransf 241: + . . . . *: 300 :QVAVAGA :Sequence : :Sec Str :======= :BL:SWS|1->247|UPPS_AGRT5|e-140|100.0|247/247