[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bp441:30.2"

30.2        "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1---------------2---------------11--1---------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQIEKPIILTDVDGVLVQWTSGLPYFAQKNGIRTDEILKTLVDERFRTGEELFGVNGRIA:Sequence : EEEcccTTTcccccHHHHHHHHHTccHHHHHHHHHHHTTccHHHHHHHHTTTc:Sec Str : ======================================================:RP:SCP|7->189|2b0cA1|2e-05|11.2|179/197|c.108.1.2 : ========================================================:BL:SWS|5->216|Y12F_BPT4|5e-41|42.1|209/278 61: . . . * . .: 120 :DILMREYNNSDFIKYLAGYVDAIDVVNRLKEHYDFIAITALGDSNQALMNRCCNLNTLFP:Sequence :cccccHHHHHHHHHTccccHHHHHHHHHHTTTcEEEEEcccHHHHHHHHHHHTTcGGGGG:Sec Str :============================================================:RP:SCP|7->189|2b0cA1|2e-05|11.2|179/197|c.108.1.2 :============================================================:BL:SWS|5->216|Y12F_BPT4|5e-41|42.1|209/278 121: . . + . . .: 180 :GAFKDILCVDIGETKMPHYISVKQKYKDRLVCFVDDLVSNLQDCHDAMSQLPQIHMLRTE:Sequence :GTcccEEEHHHHccTTcHHHHHHHHTccGGGEEEEccHHHHHHHHHT TEEEEcccHHH:Sec Str :============================================================:RP:SCP|7->189|2b0cA1|2e-05|11.2|179/197|c.108.1.2 :============================================================:BL:SWS|5->216|Y12F_BPT4|5e-41|42.1|209/278 181: . * . . . .: 240 :NAREVKHDIAKYHTAKNWYDIEKLLVNLNPKPIKMDLSHLSTWEDKPVTIEAKA :Sequence :HHHHHHHc EEEccGGGHHHHHTccc :Sec Str :========= :RP:SCP|7->189|2b0cA1|2e-05|11.2|179/197|c.108.1.2 :==================================== :BL:SWS|5->216|Y12F_BPT4|5e-41|42.1|209/278