[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAQ81509.1 bp441 30.2 "hypothetical protein"
MQIEKPIILTDVDGVLVQWTSGLPYFAQKNGIRTDEILKTLVDERFRTGEELFGVNGRIA
DILMREYNNSDFIKYLAGYVDAIDVVNRLKEHYDFIAITALGDSNQALMNRCCNLNTLFP
GAFKDILCVDIGETKMPHYISVKQKYKDRLVCFVDDLVSNLQDCHDAMSQLPQIHMLRTE
NAREVKHDIAKYHTAKNWYDIEKLLVNLNPKPIKMDLSHLSTWEDKPVTIEAKA
//