[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bp441:48"

48          "baseplate tail tube cap"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------1-1-1---------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKVTELIDGGVQDVVKGILKGENPAGGSTPRQPLSKITIAQFPAERNAANDSTQDFNVND:Sequence : :Sec Str : ==================================================:BL:SWS|11->340|VG48_BPT4|5e-94|52.4|330/364 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->336|PF11091|e-113|62.8|323/340|T4_tail_cap 61: . . . * . .: 120 :LYKNGLLLSAFNYSGRQTGDLRSFRTDQNNIGDYRKGVVKEAIANILMPKGQTDIDTINH:Sequence : :Sec Str :============================================================:BL:SWS|11->340|VG48_BPT4|5e-94|52.4|330/364 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->336|PF11091|e-113|62.8|323/340|T4_tail_cap 121: . . + . . .: 180 :KFNDVQQSLVERGNGSITGALSSMASHAVYGGLESITQGAFADRGEQVYIASRAMYAGAE:Sequence : :Sec Str :============================================================:BL:SWS|11->340|VG48_BPT4|5e-94|52.4|330/364 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->336|PF11091|e-113|62.8|323/340|T4_tail_cap 181: . * . . . .: 240 :NRTKTYTWQLTPRNVYDLVEIIKIYEMLSYYSYGSVEKSNTANDIRKSVDAAYKETIINP:Sequence : HHHHHHHHHHHH:Sec Str :============================================================:BL:SWS|11->340|VG48_BPT4|5e-94|52.4|330/364 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->336|PF11091|e-113|62.8|323/340|T4_tail_cap 241: + . . . . *: 300 :LTPEATHGQTTMFERITSFLSNVNVVSNPIIWTIRNFGQSSSFDSRSDIFGPAQIQSIRF:Sequence :HHHHHHHHHHHTcccEEEEEEc cccEEEEEETTccEEEEEcT :Sec Str :============================================================:BL:SWS|11->340|VG48_BPT4|5e-94|52.4|330/364 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->336|PF11091|e-113|62.8|323/340|T4_tail_cap 301: . . . . + .: 360 :DKSPDGHFGGLAVAPNLPSSFVLEVTFREILALNRSDLYSED :Sequence : :Sec Str :======================================== :BL:SWS|11->340|VG48_BPT4|5e-94|52.4|330/364 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|11->336|PF11091|e-113|62.8|323/340|T4_tail_cap