[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bp441:54"

54          "baseplate tail tube initiator"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------111-1---------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MYRLDEFQQELNKDFQRSNMFSVVFATTPSSKTTELLDGFGGFLYNNLPFGKDFAGLTQG:Sequence : #######:PROS|54->79|PS00217|SUGAR_TRANSPORT_2|PDOC00190| :============================================================:BL:SWS|1->275|VG54_BPT4|2e-89|58.8|274/320 61: . . . * . .: 120 :MISSSLNKIIVQGTQSVMRSSGVSKYLIGAMTSRTVQSILGQFEVGTYLLDFFNAGNTHT:Sequence :################### :PROS|54->79|PS00217|SUGAR_TRANSPORT_2|PDOC00190| :============================================================:BL:SWS|1->275|VG54_BPT4|2e-89|58.8|274/320 : $:RP:PFM|120->245|PF06841|2e-07|36.6|112/135|Phage_T4_gp19 121: . . + . . .: 180 :GLTVYSVQMPENRLGYEMDKFHNAPNIKLMGREYDPLVISFRMDHQASNYRAMQDWVNAV:Sequence :============================================================:BL:SWS|1->275|VG54_BPT4|2e-89|58.8|274/320 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|120->245|PF06841|2e-07|36.6|112/135|Phage_T4_gp19 181: . * . . . .: 240 :EDPVTGLRSLPADVEADIQINLHARDGIPHTVTMFGGCIPVAVSSPELSYEDNNTITTFN:Sequence :============================================================:BL:SWS|1->275|VG54_BPT4|2e-89|58.8|274/320 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|120->245|PF06841|2e-07|36.6|112/135|Phage_T4_gp19 241: + . . . . *: 300 :VTFAYRVMSVGAVNMAMVDDWLKGDLLPALGSQAGGWLSKFGPFS :Sequence :=================================== :BL:SWS|1->275|VG54_BPT4|2e-89|58.8|274/320 :$$$$$ :RP:PFM|120->245|PF06841|2e-07|36.6|112/135|Phage_T4_gp19