[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAQ81325.1 bp441 AAQ81325.1 "hypothetical protein"
MTIKRIRFKSEEHRKKFAESEWYNESFSKHMPDEFWAKYDSNKLVGYMLVDANGKKIELP
EEEGGGGITFDDEEMFHFFDEVK
//