[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bp441:AAQ81374.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIVRLNPEEGEIFEKPGNMNYPGIVHYDAARMNYYYVKDGIRHTAASSRNLRKGIHVEKT:Sequence : ======:BL:SWS|55->118|NFL_XENTR|7e-05|28.1|64/557 61: . . . * . .: 120 :LEKIYNPYVPTQKVKVEKMAQVSSQLQYEDLNCDVRVVSSEYANANARDLAKYSKLSSIA:Sequence :========================================================== :BL:SWS|55->118|NFL_XENTR|7e-05|28.1|64/557 121: . . + . . .: 180 :DIVEVSSQGINTDESYWKTSSSGYKALLSIPPVVCFEDPGAATKFCELVKSMYPNSCAKQ:Sequence 181: . * . . . .: 240 :FLELEFGRLSMNDVPSNVTKHMTWPESRGAFYIITVVHIGNGVEFGVRSVTGRDVSKIFN:Sequence 241: + . . . . *: 300 :STTSAGRVELFVDYCRRTASKK :Sequence