[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bp441:AAQ81392.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTKHKDLNRFLKNTHDTTGNKYRKSRDLNSRFADKHHFMRLLNNLLPSEMKWSSFGSRFG:Sequence 61: . . . * . .: 120 :IAKISPNHINLAAVGTHSVCGTIWVNTSFESDCVTNRLQTLEAYGVFVEVARRTNGSNHV:Sequence 121: . . + . . .: 180 :VTFSVDLPNGDKAPVKNVETKTEVVSTVDYTEPAKEPDGQNIFFAPETMQAVQLVRGVFH:Sequence 181: . * . . . .: 240 :FASVRISEIDEEIKELQARRKEIEDNIKSIKNAIGA :Sequence : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|185->214|PF12128|6e-04|36.7|30/1179|DUF3584