[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAQ81392.1 bp441 AAQ81392.1 "hypothetical protein"
MTKHKDLNRFLKNTHDTTGNKYRKSRDLNSRFADKHHFMRLLNNLLPSEMKWSSFGSRFG
IAKISPNHINLAAVGTHSVCGTIWVNTSFESDCVTNRLQTLEAYGVFVEVARRTNGSNHV
VTFSVDLPNGDKAPVKNVETKTEVVSTVDYTEPAKEPDGQNIFFAPETMQAVQLVRGVFH
FASVRISEIDEEIKELQARRKEIEDNIKSIKNAIGA
//