[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAQ81396.1 bp441 AAQ81396.1 "hypothetical protein"
MEIDDHKSWVWISSEGYPHVVIGCSEHPIEEIVENEHFESHTGFENVKQRLLDNYGHHDV
KMLEEELPWVTTALNHAAAGRTLSYIGLCDRSGMNIINSFFVIGCS
//