[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bp441:AAQ81406.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNIQKEIQEIEKRLGVEASEFKMPSVWKVARKPDWSYGAVFEQEFTAYEHKELGCFVAVY:Sequence : ===============================================:BL:SWS|14->100|GLMS_SYNY3|9e-04|31.8|85/631 61: . . . * . .: 120 :SERHRAQFVNTEGEDVIGHTERVVSVQHVEPYKTRLGTSWRVVNA :Sequence :======================================== :BL:SWS|14->100|GLMS_SYNY3|9e-04|31.8|85/631