[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bp441:AAQ81562.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKLFAFKHRNNGTLAELYHLVDEIYLVEYGCEAPVFVASSIEEMHAIIKHEHDYVINDID:Sequence : XXXXXXXX:SEG|53->69|dyvindidiideydiie 61: . . . * . .: 120 :IIDEYDIIEFEAKPKLIEGNCIGTP :Sequence :XXXXXXXXX :SEG|53->69|dyvindidiideydiie