[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAQ81567.1 bp441 AAQ81567.1 "hypothetical protein"
MQTYEFIKRRARPGCGQQKKELMAEHKMLRAMVDHHTIMCYDREPSPELLKARSDKERIE
NLLLEITS
//