[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bp441:a-gt.5"

a-gt.5      "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKTNLKLDLESLFDSVCGEVDLMSYFVKLQMRDYKIPVEINPMNISWQPFEVTSGQLDWH:Sequence 61: . . . * . .: 120 :IDAETMTMEIEYVA :Sequence