[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAQ81365.1 bp441 a-gt.5 "hypothetical protein"
MKTNLKLDLESLFDSVCGEVDLMSYFVKLQMRDYKIPVEINPMNISWQPFEVTSGQLDWH
IDAETMTMEIEYVA
//