[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bp441:cd"

cd          "dCMP deaminase"
            ""

OrgPattern -----------------------1------------------------11211-1111111111--11 ---------------------------------------------------------------1---------------1111-----1111-1111--111111-11-1---------------11111111111-----111----1-111-----------------1-------------------1111111111111111111111111111111111-111111-1111111111111111111111111-11111111111111111-111111111111111111111111111111111111111111111111111-----------12111111--11111111111111-1111111-11-----------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------1111111111111-111111111111111121-------------------1----------------------111----1-11-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111----------------1---------------111----1--11-1-----11-------1111111111-1- --11--1-----1111111-111---111-111-11-11---111111111111---1----11-111111--111111111111111-1211--111111---1--1--212111-1111-1122-1-342-122111-21-11-1-1-1--1-11112311111-211-11111--191111111121111111111 ---1---------------1---------------111-1--------------------------------------------------1-----1-----------------1---------------------------------------------------------1--

Master   AminoSeq   


1: . . . . + .: 60 :MKVSSVLQHAYIVAQESHCVSWKVGAIITKDGRIISTGYNGTPAGGHENCDDHAKAAGWL:Sequence :ccHHHEHHHHHHHHHHHHTTTcccEEEEEETTEEEEEEEccHHHHTcGccTTcHHHHGcc:Sec Str :============================================================:RP:SCP|1->154|1vq2A|2e-30|66.0|153/173|c.97.1.2 :============================================================:BL:SWS|1->154|DCTD_BPT2|6e-53|67.3|153/188 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->132|PF00383|3e-14|51.2|80/100|dCMP_cyt_deam_1 61: . . . * . .: 120 :DPETGKLKAMYRQAHNEWSSCNEIHAELNAILYAAKSGQSIDGAEMYVTVSPCRECAKAI:Sequence :cTTHHHHHHHHHHEETTccGGTTccHHHHHHHHHHHTccccTTcEEEEEEcccHHHHHHH:Sec Str : ####################################:PROS|85->120|PS00903|CYT_DCMP_DEAMINASES|PDOC00702| :============================================================:RP:SCP|1->154|1vq2A|2e-30|66.0|153/173|c.97.1.2 :============================================================:BL:SWS|1->154|DCTD_BPT2|6e-53|67.3|153/188 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->132|PF00383|3e-14|51.2|80/100|dCMP_cyt_deam_1 121: . . + . . .: 180 :AQSGIKKVFYNELYDRNTPGWDEILVKSGIKVIHNKVPLNLLKKEFTVSNQN :Sequence :HHHTccEEEEEEccTcTcTTcccGGGcTTcccGccEEEccTTHHHH :Sec Str :================================== :RP:SCP|1->154|1vq2A|2e-30|66.0|153/173|c.97.1.2 :================================== :BL:SWS|1->154|DCTD_BPT2|6e-53|67.3|153/188 :$$$$$$$$$$$$ :RP:PFM|19->132|PF00383|3e-14|51.2|80/100|dCMP_cyt_deam_1