[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bp441:dda"

dda         "DNA helicase"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------111---------11--------------1-----1---------------------------------------------------------------------------------------------------------------------------------------------------111--1------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---11-1---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1---------------1---------------111-1---------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLTYDDLTNGQKLAIDGAMDAISTKRHITIRGPAGTGKTTLTKFLLDRLFQTGQQGIVLA:Sequence : EEEE:Sec Str : XXXXXXXXXXXX :SEG|35->46|gtgkttltkfll : ===========================================================:RP:SCP|2->172|1w36D1|4e-10|21.6|167/348|c.37.1.19 : ===========================================================:BL:SWS|2->439|DDA_BPT4|e-107|49.0|433/439 61: . . . * . .: 120 :APTHQAKKELSKHALRKAYTIQSLLKINPSTLEENQIFEQKGTPDFSKIRVLICDEVSFY:Sequence :EccHHHHHHHHHHHTccEEEHHHHTTEETTEEcccccccccTccccccccEEEEccGGGc:Sec Str :============================================================:RP:SCP|2->172|1w36D1|4e-10|21.6|167/348|c.37.1.19 :============================================================:BL:SWS|2->439|DDA_BPT4|e-107|49.0|433/439 121: . . + . . .: 180 :TRKLFNILMKTVPSHCVIIGIGDKAQIRGVSEDNETHELSPFFTDDRFSQVELDEVKRHQ:Sequence :cHHHHHHHHTTccTTcEEEEEEcTTccGGTccccHHHHHHHHccEEEccccccccTT :Sec Str :==================================================== :RP:SCP|2->172|1w36D1|4e-10|21.6|167/348|c.37.1.19 :============================================================:BL:SWS|2->439|DDA_BPT4|e-107|49.0|433/439 181: . * . . . .: 240 :GPIIEVATDIRNGKWIYEKLDEHGNGVKQYHSVKDFLGVYFNRTKKPEDLFENRIMAYTN:Sequence :cHHHHHHHHHTTTc :Sec Str :============================================================:BL:SWS|2->439|DDA_BPT4|e-107|49.0|433/439 241: + . . . . *: 300 :ASVDKLNAVIRKKLYGSDVAPFLPGEILVMQEPLMFEIDVGGQTLKEVIFSNGQNVQILN:Sequence : :Sec Str :============================================================:BL:SWS|2->439|DDA_BPT4|e-107|49.0|433/439 301: . . . . + .: 360 :VKPSRKKLVAKNVGEIEVEYIMLECETHDEDEDDYKRAWFSVIADDNTAQAISEFLSIIA:Sequence : :Sec Str :============================================================:BL:SWS|2->439|DDA_BPT4|e-107|49.0|433/439 361: . . . * . .: 420 :DKYRSRAVFPAWKDFWAIKNTFTKVRPLGAMTFHKSQGSTFKNAYLFTPCLHSYCRDPDV:Sequence : TccEEEccccccccccEEEEEGGGcTTccEEEEEEEcETccTTTcccGG:Sec Str : ==========================================:RP:SCP|379->439|1w36D2|2e-05|35.1|57/190|c.37.1.19 :============================================================:BL:SWS|2->439|DDA_BPT4|e-107|49.0|433/439 421: . . + . . .: 480 :AQELIYVGNTRARENVGFV :Sequence :GHHHHHHHHTTEEEEE :Sec Str :=================== :RP:SCP|379->439|1w36D2|2e-05|35.1|57/190|c.37.1.19 :=================== :BL:SWS|2->439|DDA_BPT4|e-107|49.0|433/439