[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bp441:denV"

denV        "endonuclease V"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111------------------------1--------------------------------------------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-------1------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1---1-----------------------------------------------------------------------------------------------------------------------------------11--

Master   AminoSeq   


1: . . . . + .: 60 :MTRINLEHPSLLCNAHLVGEWYENPRVASILIKKNGRTGKIPKRFTVRTNKNPDGGRGHV:Sequence : cccccccGGGccHHHHHHHHHHTTHHHHH HHHHHHTTccGGGccccccccc cTTTT:Sec Str : ===========================================================:RP:SCP|2->126|1eniA|9e-05|37.2|121/137|a.18.1.1 :============================================================:BL:SWS|1->129|END5_BPT4|5e-15|39.5|124/138 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->129|PF03013|2e-19|51.4|111/121|Pyr_excise 61: . . . * . .: 120 :TFFYNKLAWLRDRYLMLMDEMTKRGYSPTDNWKVEIFFPEYTHLFGEWTPTEADISLSRT:Sequence :GGGTTcHHHHHHHHHHHHHHHHHTTcccccccccccTccG GGcccccccHHHHHHHHH:Sec Str :============================================================:RP:SCP|2->126|1eniA|9e-05|37.2|121/137|a.18.1.1 :============================================================:BL:SWS|1->129|END5_BPT4|5e-15|39.5|124/138 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->129|PF03013|2e-19|51.4|111/121|Pyr_excise 121: . . + . . .: 180 :RIAEMIPEKHKLTNEQLEKLSAIAEYEAFNEK :Sequence :HHHHHHHHc :Sec Str :====== :RP:SCP|2->126|1eniA|9e-05|37.2|121/137|a.18.1.1 :========= :BL:SWS|1->129|END5_BPT4|5e-15|39.5|124/138 :$$$$$$$$$ :RP:PFM|1->129|PF03013|2e-19|51.4|111/121|Pyr_excise