[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bp441:ndd"

ndd         "nucleoid disruption protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSKQNLNVQRIISAGAQRLGHFENGNFKFVTGKSKDDARGKGFYFIVSAGVVKARTFVGD:Sequence : =======================================================:BL:SWS|6->143|NDD_BPR70|3e-06|27.4|135/147 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->143|PF06591|2e-13|37.8|135/148|Phage_T4_Ndd 61: . . . * . .: 120 :QETNRGFNETIYRVCHGFQPLTDEIWSKSYSLNQVVYFMPLHLVPSLLKSPAQLELFGEN:Sequence :============================================================:BL:SWS|6->143|NDD_BPR70|3e-06|27.4|135/147 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->143|PF06591|2e-13|37.8|135/148|Phage_T4_Ndd 121: . . + . . .: 180 :MAKAQTLTTVSRQLFKVYNFEYQKR :Sequence :======================= :BL:SWS|6->143|NDD_BPR70|3e-06|27.4|135/147 :$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->143|PF06591|2e-13|37.8|135/148|Phage_T4_Ndd