[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAQ81560.1 bp441 ndd "nucleoid disruption protein"
MSKQNLNVQRIISAGAQRLGHFENGNFKFVTGKSKDDARGKGFYFIVSAGVVKARTFVGD
QETNRGFNETIYRVCHGFQPLTDEIWSKSYSLNQVVYFMPLHLVPSLLKSPAQLELFGEN
MAKAQTLTTVSRQLFKVYNFEYQKR
//