[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bp441:tk"

tk          "thymidine kinase"
            ""

OrgPattern ------------------11--1----------------------------------1111------- ----1---------------------------------------11111111111111--111111-111-------------------------------------------------------------------------------------------------------------------------1-----------------1-11----1---1---1111111--11111111111111-----1111-11111111111111111111111111111111111111111111111111111111211111111--1-1-------1-1----11111--1----------------11-------1-------------------------------------------1--1111111111-1--111111----111----------------------------------------------11111----------------------------------------------1---------1-------------------------------------------------------------------------11-1--111111111111111111111111-------------11111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111--111111111----1111111111111111-----------------------------111111111-111111111111111111111111---------------------------------1----------11-1111--1111111--- --11------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------1----------1---------- ---1---------------1---------------111-1---------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAKLHFHYAAMNSGKSTHLLQVAYNYMERNMKPLILKPAIDTRDGDNVSSRIGISQKAHM:Sequence : EEEEEccTTccHHHHHHHHHHHHHHTTccEEEEEEcccTTcccccccHHHHHHHHHH:Sec Str : =====================================================:RP:SCP|8->110|1oftA|6e-06|13.6|103/119|c.37.1.22 :============================================================:BL:SWS|1->186|KITH_IDILO|6e-51|50.5|186/193 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->184|PF00265|2e-38|46.7|182/184|TK 61: . . . * . .: 120 :ISQDDNLKAFCEKLIELDGIDCILVDEAQFLTVDQVHQLGDVVDYINVPVMCYGLLSDSN:Sequence :EcEEEEEccGGGGGcccTTccEEEEccGGGccTHHHHHHHHHHHTHTcEEEEEEEEEEEc:Sec Str :================================================== :RP:SCP|8->110|1oftA|6e-06|13.6|103/119|c.37.1.22 :============================================================:BL:SWS|1->186|KITH_IDILO|6e-51|50.5|186/193 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->184|PF00265|2e-38|46.7|182/184|TK 121: . . + . . .: 180 :GHLFPASAELLVLAERKVEHETICWCGKKATMTMRMNEHGEKIWGPRVSIGGNDRFISVC:Sequence :cTTcccTTHHHHHccEEEEEcEEcTTccEEcEEEEEETTEEccTcccccccccEEEEEEc:Sec Str : ======================================:RP:SCP|143->191|2b8tA2|9e-15|30.6|49/67|g.39.1.14 :============================================================:BL:SWS|1->186|KITH_IDILO|6e-51|50.5|186/193 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|2->184|PF00265|2e-38|46.7|182/184|TK 181: . * . . . .: 240 :RRHWKEGKIQK :Sequence :GGGcccHHTcc :Sec Str :=========== :RP:SCP|143->191|2b8tA2|9e-15|30.6|49/67|g.39.1.14 :====== :BL:SWS|1->186|KITH_IDILO|6e-51|50.5|186/193 :$$$$ :RP:PFM|2->184|PF00265|2e-38|46.7|182/184|TK