[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAQ81419.1 bp441 tk "thymidine kinase"
MAKLHFHYAAMNSGKSTHLLQVAYNYMERNMKPLILKPAIDTRDGDNVSSRIGISQKAHM
ISQDDNLKAFCEKLIELDGIDCILVDEAQFLTVDQVHQLGDVVDYINVPVMCYGLLSDSN
GHLFPASAELLVLAERKVEHETICWCGKKATMTMRMNEHGEKIWGPRVSIGGNDRFISVC
RRHWKEGKIQK
//