[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bp441:vs.6"

vs.6        "Vs.6"
            ""

OrgPattern -------------------------------------------------------------------- -----1------------------------------------------1---------------1------11111111---------1111-2----------------------------------------------------1-1----11----------1--------------------------1-111111111111111--11--1111----11111111-1111111111111111111--1---11-----11--1111----------------------------------------------------2-121111111111211111111-1-1111---1-1-11--------11-----------------1---2--1------------------------------------------------------------------2----------------------------------1--------------------------------------------------------1-------------1-1---------------------------------------------------------222-------21111111111111111111--1----------33222323332333333-3333333333333333332333221123333333333333333233333332-322222222222------------------222222222222222---------------------------------------23322222232222----------------------------------1-------------------------------------1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------121-1111---------4----- ---1-------------------------------111-1------------------------------------------------------------------------------------------------------------------------1--------------

Master   AminoSeq   


1: . . . . + .: 60 :MLIGFQLLDGSNDHGSIFLVDDQTNNAKVIASKTYEIDTIVEDSVIRGRPGRFFDVQPEP:Sequence : HHHcccc:Sec Str : ==============================:RP:SCP|31->120|1r8wA|7e-26|32.2|90/786|c.7.1.1 :============================================================:BL:SWS|1->122|GRCA_VIBHB|1e-34|58.2|122/125 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|20->103|PF01228|5e-17|56.0|75/106|Gly_radical 61: . . . * . .: 120 :TVEGGQHLNVNVLDRNTLEDAIVNPEKYPQLTIRVSGYAVRFNALTPEQQRDVITRTFTQ:Sequence :ccccccEEEEEEccHHHHHHHHHcGGGcTTcEEEccccEEEGGGccHHHHHHHHTccccc:Sec Str : ######### :PROS|92->100|PS00850|GLY_RADICAL_1|PDOC00665| :============================================================:RP:SCP|31->120|1r8wA|7e-26|32.2|90/786|c.7.1.1 :============================================================:BL:SWS|1->122|GRCA_VIBHB|1e-34|58.2|122/125 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|20->103|PF01228|5e-17|56.0|75/106|Gly_radical 121: . . + . . .: 180 :SL :Sequence :cc :Sec Str :== :BL:SWS|1->122|GRCA_VIBHB|1e-34|58.2|122/125