[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bpsp3:orf4"

orf4        "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1-----------2-1---11-111---11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------1----------------1-----------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPDITNGREKVNDFLKDKGIKKTSLAIAYGFKRQEVTNILSGTTKGPRANSFILQVIEDY:Sequence 61: . . . * . .: 120 :GIE :Sequence