[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>NP_150137.1 bpsp3 orf4 "hypothetical protein"
MPDITNGREKVNDFLKDKGIKKTSLAIAYGFKRQEVTNILSGTTKGPRANSFILQVIEDY
GIE
//