[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bptp0:NP_112700.1"

            "ORF37"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------1------------------------------------------------------11---------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGRLLSRHLHKYKNINATKQVKNDELTTLTVNQLKELLETKGIEYTKNDKKSDLISKLGV:Sequence : ================================== :RP:SCP|25->58|1y02A1|2e-04|23.5|34/44|a.140.2.1 61: . . . * . .: 120 :AYGYH :Sequence