[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bpvp2:AAR97635.1"

            "outer capsid protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAVYIQGQEVLNIVVHVPNSAPTDLGEFRMAEQLAAKQPQITAQPVGGSIYDSQTLGLSI:Sequence : :Sec Str : ==================:BL:SWS|43->153|HOC_BPT4|3e-06|24.3|111/376 61: . . . * . .: 120 :AANVFGSTAAYQWLVDGAPIQGANSTSFTFVPSGLGTFDVTCEIKAFGPMVTSEVASVTV:Sequence : :Sec Str :============================================================:BL:SWS|43->153|HOC_BPT4|3e-06|24.3|111/376 121: . . + . . .: 180 :EQTPVDLTWQVLPAGYGLPSNVSGLVGLNAIGSDGSLVVGAMGMEGMRSTDKGLTWSYIG:Sequence : ccE EcccTTccTTcEEEEEEccccTTcEEEEEccccEEEEEEcccEEEETT:Sec Str :================================= :BL:SWS|43->153|HOC_BPT4|3e-06|24.3|111/376 181: . * . . . .: 240 :NGFGTGQTSGTISAICVVGNVVVVGGIAGSNIGVAGRSTNGGVSWTKLPDFLNSGATASA:Sequence :cccTTcccEEEEccEEEcccccTTcEEEEcccccEEEEccTTcccEEcccccTTccTTcc:Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|197->216|vvgnvvvvggiagsnigvag : ========================:RP:SCP|217->420|1sntA|1e-08|15.7|204/352|b.68.1.1 : =======================:BL:SWS|218->431|P2SAF_CYAPA|7e-05|30.8|185/333 241: + . . . . *: 300 :INKILHVGGNKLIALLGSGYAAVSNDLGATWSALPRWLNSGGSDNNTSFFDGAVTATGAI:Sequence :cEEEEcTTcccEEEEcccccccEEccTTcccccccccccccEEEccccccEEEccccTTc:Sec Str :============================================================:RP:SCP|217->420|1sntA|1e-08|15.7|204/352|b.68.1.1 :============================================================:BL:SWS|218->431|P2SAF_CYAPA|7e-05|30.8|185/333 301: . . . . + .: 360 :IAVGQNGFASISRNGGVTWSALPRYLGMPTNTSIVAIGVSDTAIVVGGNNGNCAISRNDG:Sequence :EEEEETTEEEEEccTTcccEEEccTccccccccEEEEEccccTEEEEETTTEEEEEccTT:Sec Str :============================================================:RP:SCP|217->420|1sntA|1e-08|15.7|204/352|b.68.1.1 :============================================================:BL:SWS|218->431|P2SAF_CYAPA|7e-05|30.8|185/333 361: . . . * . .: 420 :VTWSALPLNFGVPIGSGIRDRSIAGASNGTFLVGLSGSPISGNNGYLALSYDDGVTWQQP:Sequence :cccEEcTcTcTTTcEEEEEEEEccccTTcccEEEEEEEccTTcccEEEEEccTTcccEEE:Sec Str :============================================================:RP:SCP|217->420|1sntA|1e-08|15.7|204/352|b.68.1.1 :============================================================:BL:SWS|218->431|P2SAF_CYAPA|7e-05|30.8|185/333 421: . . + . . .: 480 :PRYLGIPNAGYGALVNTIRNIDILTFLVGFTDKRGVRAVR :Sequence :EHHHTcTHH :Sec Str :=========== :BL:SWS|218->431|P2SAF_CYAPA|7e-05|30.8|185/333