[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAR97635.1 bpvp2 AAR97635.1 "outer capsid protein"
MAVYIQGQEVLNIVVHVPNSAPTDLGEFRMAEQLAAKQPQITAQPVGGSIYDSQTLGLSI
AANVFGSTAAYQWLVDGAPIQGANSTSFTFVPSGLGTFDVTCEIKAFGPMVTSEVASVTV
EQTPVDLTWQVLPAGYGLPSNVSGLVGLNAIGSDGSLVVGAMGMEGMRSTDKGLTWSYIG
NGFGTGQTSGTISAICVVGNVVVVGGIAGSNIGVAGRSTNGGVSWTKLPDFLNSGATASA
INKILHVGGNKLIALLGSGYAAVSNDLGATWSALPRWLNSGGSDNNTSFFDGAVTATGAI
IAVGQNGFASISRNGGVTWSALPRYLGMPTNTSIVAIGVSDTAIVVGGNNGNCAISRNDG
VTWSALPLNFGVPIGSGIRDRSIAGASNGTFLVGLSGSPISGNNGYLALSYDDGVTWQQP
PRYLGIPNAGYGALVNTIRNIDILTFLVGFTDKRGVRAVR
//