[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bsub0:aprX"

aprX        "alkaline serine protease"
            ""

OrgPattern 111-------------1-11-1-2------13--------------1812-2---3-234------1- ------1-111---1---------1------1------3121-1-3-2-1-1--421---6911B3397C------------21-1--111--------1-122-11121---------------1--1---1-3134456-1-81243-11111----11-211-16343----1--1----C32-1--1-263333344436435445988774633233733------931--------------------1--------1----11-------------------------------------------1---------311231111111111-122111111---4111---22124312212-2--1-1------------1-1-------------------1----2-------------1-------1-------------------------------------------------------------------1----1-1111---12222-211-1-1------1--------------------------1111--4---------1----122-413----1-53-1-------1-------------------1--21-4211-2-11141-322-11---13--3-----------------------------------------------------1---------------------------1--------------9---------1-1-----------------11111------1------1---------------------1-11111121111--22123-----------------------------------------------------2-121-------- ---1451-1---135556323323223332222987886887812211978A8A5573312283322213333333323324444422-1-154-11-111218BA1193D3111311--1-2-54-2-4B2142311-11-21211-1-3-1311223--33911-111---11-122G221432BBW5HDB559581 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFGYSMVQMVRANAHKLDWPLRETVLQLYKPFKWTPCFLHKFFETKLQNRKKMSVIIEFE:Sequence : EEEEEEc:Sec Str 61: . . . * . .: 120 :EGCHETGFQMAGEVLQKEKRSKLKSRFNKINCCSAEVTPSALHSLLSECSNIRKVYLNRE:Sequence :TT TccHHHHHHTTcEEEEEccccccEEEEccccccccG GGTTTEEEEETccc:Sec Str : ==========:BL:SWS|111->435|ELYA_BACHD|3e-34|38.3|277/361 121: . . + . . .: 180 :VKALLDTATEASHAKEVVRNGQTLTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTE:Sequence :ccccccccccHHHHHHHTTccTTcccTTcEEEEEEccccTTcccccccEEEEccTTcccT:Sec Str : ########### :PROS|151->161|PS00136|SUBTILASE_ASP|PDOC00125| : =======================================:RP:SCP|142->436|1a2qA|7e-53|43.8|249/275|c.41.1.1 :============================================================:BL:SWS|111->435|ELYA_BACHD|3e-34|38.3|277/361 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|145->410|PF00082|6e-41|48.8|242/285|Peptidase_S8 181: . * . . . .: 240 :PYDDNGHGTHCAGDVASSGASSSGQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCI:Sequence :TcccccHHHHHHHHHHccccccccHHHHHcTTcEEEEEEcccTTccccHHHHHHHHHHHH:Sec Str : XXXXXXXXX :SEG|196->204|assgasssg : ########### :PROS|187->197|PS00137|SUBTILASE_HIS|PDOC00125| :============================================================:RP:SCP|142->436|1a2qA|7e-53|43.8|249/275|c.41.1.1 :============================================================:BL:SWS|111->435|ELYA_BACHD|3e-34|38.3|277/361 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|145->410|PF00082|6e-41|48.8|242/285|Peptidase_S8 241: + . . . . *: 300 :QYNEDNPDEPIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQT:Sequence :HTTHHHHcccccEEEEccccccEcccHcccHHHHHHHHHHHHTTcEEEEEcccccccccc:Sec Str :============================================================:RP:SCP|142->436|1a2qA|7e-53|43.8|249/275|c.41.1.1 :============================================================:BL:SWS|111->435|ELYA_BACHD|3e-34|38.3|277/361 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|145->410|PF00082|6e-41|48.8|242/285|Peptidase_S8 301: . . . . + .: 360 :IASPGVSEKVITVGALDDNNTASSDDDTVASFSSRGPTVYGKEKPDILAPGVNIISLRSP:Sequence :cccTTTcTTcEEEEEEcTTcccTEEEEcccEEcTTccccTTccTccEEEEcccEEEEETT:Sec Str : XXXXXXXXXXXXXX :SEG|315->328|alddnntassdddt :============================================================:RP:SCP|142->436|1a2qA|7e-53|43.8|249/275|c.41.1.1 :============================================================:BL:SWS|111->435|ELYA_BACHD|3e-34|38.3|277/361 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|145->410|PF00082|6e-41|48.8|242/285|Peptidase_S8 361: . . . * . .: 420 :NSYIDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKW:Sequence :TEEEcGGcEEEETTTEEEEEccHHHHHHHHHHHHHHHHHHcTTccHHHHHHHHHHTcccc:Sec Str : ########### :PROS|382->392|PS00138|SUBTILASE_SER|PDOC00125| :============================================================:RP:SCP|142->436|1a2qA|7e-53|43.8|249/275|c.41.1.1 :============================================================:BL:SWS|111->435|ELYA_BACHD|3e-34|38.3|277/361 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|145->410|PF00082|6e-41|48.8|242/285|Peptidase_S8 421: . . + . . .: 480 :KDEDPNIYGAGAVNAENSVPGQ :Sequence :ccccHHHHTTccccHHHHTTTE :Sec Str :================ :RP:SCP|142->436|1a2qA|7e-53|43.8|249/275|c.41.1.1 :=============== :BL:SWS|111->435|ELYA_BACHD|3e-34|38.3|277/361