[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bsub0:gabP"

gabP        "gamma-aminobutyrate (GABA) permease"
GABP_BACSU  "RecName: Full=GABA permease;AltName: Full=4-amino butyrate transport carrier;AltName: Full=Gamma-aminobutyrate permease;"

OrgPattern --------11111---------------------1------------1--------------11---- ---1152333424251244-412253444443-11117DD----2-21122288A824-----A119755-5222555-----------------------1------1--------------------1-------------------------------------------------------------31A7787878868A888911668B88754591712222227155555555555555466667155243273547766432536416662222111-22-----------1111111111111-212221111---54222222211---441111----------2212--1-11--1-------1--134334-------------1-111111112------2------111-111--1--1--------------44444444-223----------------1-11-111111111-1----11-211-18BBBB836565AA33888848D825555-1443--1--7----1-------41---------1-----------3--------------------1-----1-------3-1112111-------111---------------------------1------------87676859888988888-88A8888878888888888CCC797749899999999999899B88877784-888788788888--3------1111--------------------FFGGDA8-----88789A49-DHDB1333333333333---------------2233333333--------------------------------------------------------------- ------------322HGBBMFDBPMOM9A8678DEBDCCCCADA9AFGGHOTjaDCG99AAAFMPFGJ4MEEODOIHAHJDKLMQNE8-6J4G6AC6473988879-------------------------------------1--------------239-1-1-----4--------------1--2B----1-1-- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNQSQSGLKKELKTRHMTMISIAGVIGAGLFVGSGSVIHSTGPGAVVSYALAGLLVIFIM:Sequence : HHHHHHHHHTTcHHHHHHHHHH HHTTTHHHHHHHHHHHHHHHH:Sec Str : ####################:PROS|41->71|PS00218|AMINO_ACID_PERMEASE_1|PDOC00191| :============================================================:BL:SWS|1->469|GABP_BACSU|0.0|100.0|469/469 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->421|PF00324|1e-43|35.4|398/429|AA_permease 61: . . . * . .: 120 :RMLGEMSAVNPTSGSFSQYAHDAIGPWAGFTIGWLYWFFWVIVIAIEAIAGAGIIQYWFH:Sequence :HHHHHHHHHcccccccHHHHHHHHccHHHHHHHHHHH :Sec Str : XXXXXXXXXXXXXXX :SEG|101->115|viviaieaiagagii :########### :PROS|41->71|PS00218|AMINO_ACID_PERMEASE_1|PDOC00191| :============================================================:BL:SWS|1->469|GABP_BACSU|0.0|100.0|469/469 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->421|PF00324|1e-43|35.4|398/429|AA_permease 121: . . + . . .: 180 :DIPLWLTSLILTIVLTLTNVYSVKSFGEFEYWFSLIKVVTIIAFLIVGFAFIFGFAPGSE:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|124->138|lwltsliltivltlt :============================================================:BL:SWS|1->469|GABP_BACSU|0.0|100.0|469/469 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->421|PF00324|1e-43|35.4|398/429|AA_permease 181: . * . . . .: 240 :PVGFSNLTGKGGFFPEGISSVLLGIVVVIFSFMGTEIVAIAAGETSNPIESVTKATRSVV:Sequence : THHHHHHTTGGGcccHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXXX :SEG|197->212|gissvllgivvvifsf :============================================================:BL:SWS|1->469|GABP_BACSU|0.0|100.0|469/469 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->421|PF00324|1e-43|35.4|398/429|AA_permease 241: + . . . . *: 300 :WRIIVFYVGSIAIVVALLPWNSANILESPFVAVLEHIGVPAAAQIMNFIVLTAVLSCLNS:Sequence :HHHHHHHHHHHHHHHTTccHGHHHHHHHHHHHHHHHHHHHHHH HHHHHHHHHH:Sec Str :============================================================:BL:SWS|1->469|GABP_BACSU|0.0|100.0|469/469 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->421|PF00324|1e-43|35.4|398/429|AA_permease 301: . . . . + .: 360 :GLYTTSRMLYSLAERNEAPRRFMKLSKKGVPVQAIVAGTFFSYIAVVMNYFSPDTVFLFL:Sequence :HHTTTHHHHHHHHHHccccccccTccTHHHHHHHHH HHHHHHH ccHHHH :Sec Str :============================================================:BL:SWS|1->469|GABP_BACSU|0.0|100.0|469/469 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->421|PF00324|1e-43|35.4|398/429|AA_permease 361: . . . * . .: 420 :VNSSGAIALLVYLVIAVSQLKMRKKLEKTNPEALKIKMWLFPFLTYLTIIAICGILVSMA:Sequence :HHHHHHHHHHHHHHHHHH :Sec Str :============================================================:BL:SWS|1->469|GABP_BACSU|0.0|100.0|469/469 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->421|PF00324|1e-43|35.4|398/429|AA_permease 421: . . + . . .: 480 :FIDSMRDELLLTGVITGIVLISYLVFRKRKVSEKAAANPVTQQQPDILP :Sequence : :Sec Str :================================================= :BL:SWS|1->469|GABP_BACSU|0.0|100.0|469/469 :$ :RP:PFM|19->421|PF00324|1e-43|35.4|398/429|AA_permease