[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bsub0:mecA"

mecA        "adaptor protein controlling oligomerization of the AAA+ protein ClpC"
MECA1_BACSU  "RecName: Full=Adapter protein mecA 1;"

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------12222222222222222212222222222212111111111-11111111111111111111--1-11-1---11111111-11-1---------1-------------11---111111111--111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEIERINEHTVKFYMSYGDIEDRGFDREEIWYNRERSEELFWEVMDEVHEEEEFAVEGPL:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|43->57|evmdevheeeefave :============================================================:BL:SWS|1->218|MECA1_BACSU|e-114|100.0|218/218 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->213|PF05389|1e-24|39.8|211/224|MecA 61: . . . * . .: 120 :WIQVQALDKGLEIIVTKAQLSKDGQKLELPIPEDKKQEPASEDLDALLDDFQKEEQAVNQ:Sequence : HHHTccEEEEccTTTccccTTc cTTccccHHHHHHHHTTccGGGEEEEc:Sec Str :============================================================:BL:SWS|1->218|MECA1_BACSU|e-114|100.0|218/218 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->213|PF05389|1e-24|39.8|211/224|MecA 121: . . + . . .: 180 :EEKEQKLQFVLRFGDFEDVISLSKLNVNGSKTTLYSFENRYYLYVDFCNMTDEEVENQLS:Sequence :ccHccccEEEEEEccHHHHHHHHHTTccccEEEEEEETTEEEEEEEcTTccHHHHHHHHH:Sec Str :============================================================:BL:SWS|1->218|MECA1_BACSU|e-114|100.0|218/218 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->213|PF05389|1e-24|39.8|211/224|MecA 181: . * . . . .: 240 :ILLEYATESSISIHRLEEYGKLIISEHALETIKKHFAS :Sequence :HHTTTcEEccccHHHHHHHcEEEEcccHHHHHHHHHcc :Sec Str :====================================== :BL:SWS|1->218|MECA1_BACSU|e-114|100.0|218/218 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->213|PF05389|1e-24|39.8|211/224|MecA