[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>CAB13009.1 bsub0 mecA "adaptor protein controlling oligomerization of the AAA+ protein ClpC"
MEIERINEHTVKFYMSYGDIEDRGFDREEIWYNRERSEELFWEVMDEVHEEEEFAVEGPL
WIQVQALDKGLEIIVTKAQLSKDGQKLELPIPEDKKQEPASEDLDALLDDFQKEEQAVNQ
EEKEQKLQFVLRFGDFEDVISLSKLNVNGSKTTLYSFENRYYLYVDFCNMTDEEVENQLS
ILLEYATESSISIHRLEEYGKLIISEHALETIKKHFAS
//