[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "bsub0:menH"

menH        "menaquinone methyltransferase"
UBIE_BACSU  "RecName: Full=Menaquinone biosynthesis methyltransferase ubiE;         EC=2.1.1.-;AltName: Full=Spore germination protein C2;"

OrgPattern ------11------11--------123221221------12--2213512854-1113131-111--- 1452111111111122111-121121111112422231221122112122212221111121111121111--------1111112111111-111-111111112111111111111111111111112211131111324442133153322111111111321132221-112221111221211---21222222222122221212111222112111111111111111111111111111111111--1----11-11111-----11--11----------------------------------------------2-31111111-1---11---------3--1311321---23----11-211211111111122111111111111111111111-1111111122212111122222221112113111111111111111111122111111111111111111111111111111111212111111122212122222112222222211111111122111111122231112211111111111113112114311211131111113111111111111313111111111111111111111111112111111111111111111111111111111--13212------22111211111111111-11111111111111111112221211121111211111121112111111111211111111111111111111111131211111-1-1----111111111112111211211121122121111111111111111111111111111111111111111111121112211-----------------------------------------1-222111 11-124--311-11121221231242211111112111111111-1222211121121111111211111113111111111111212-56311121111112114--2121211111-11111111-12B1-11211-1111111111-11-1121111--11111111112112224c4452331122423322112 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQDSKEQRVHGVFEKIYKNYDQMNSVISFQQHKKWRDKTMRIMNVKEGAKALDVCCGTAD:Sequence :ccccHHHHGGGccHHHHHHHHHHHHHTTccHGGcccHHHHHHHGGGcccEEEEEccTTcH:Sec Str : ################ :PROS|20->35|PS01183|UBIE_1|PDOC00911| : ================================================:RP:SCP|13->222|2gh1A1|2e-28|16.9|195/281|c.66.1.49 :============================================================:BL:SWS|1->233|UBIE_BACSU|e-138|100.0|233/233 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->233|PF01209|5e-57|42.9|233/234|Ubie_methyltran 61: . . . * . .: 120 :WTIALAKAAGKSGEIKGLDFSENMLSVGEQKVKDGGFSQIELLHGNAMELPFDDDTFDYV:Sequence :HHHHHHHHcTTcEEHHEEEEcHHHHHHHHHHHTTcTTGGEEEEcccccccccccccccEE:Sec Str :============================================================:RP:SCP|13->222|2gh1A1|2e-28|16.9|195/281|c.66.1.49 :============================================================:BL:SWS|1->233|UBIE_BACSU|e-138|100.0|233/233 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->233|PF01209|5e-57|42.9|233/234|Ubie_methyltran 121: . . + . . .: 180 :TIGFGLRNVPDYLTVLKEMRRVVKPGGQVVCLETSQPEMFGFRQAYFMYFKYIMPFFGKL:Sequence :EEEcccTTccHHHHHHHHHHHHccTTcEEEEEEccTTccccHHHHHHHHHHcEEcccccT:Sec Str : ############### :PROS|141->155|PS01184|UBIE_2|PDOC00911| :============================================================:RP:SCP|13->222|2gh1A1|2e-28|16.9|195/281|c.66.1.49 :============================================================:BL:SWS|1->233|UBIE_BACSU|e-138|100.0|233/233 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->233|PF01209|5e-57|42.9|233/234|Ubie_methyltran 181: . * . . . .: 240 :FAKSYKEYSWLQESARDFPGMKELAGLFEEAGLKNVKYHSFTGGVAATHIGWK :Sequence :TccEHHHHHHccccccccccHHHHHHHHHTTTEEEcccccccTTTcEEEEEEE :Sec Str :========================================== :RP:SCP|13->222|2gh1A1|2e-28|16.9|195/281|c.66.1.49 :===================================================== :BL:SWS|1->233|UBIE_BACSU|e-138|100.0|233/233 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->233|PF01209|5e-57|42.9|233/234|Ubie_methyltran